Gene Synthesis                                            
progress bar
progress bar

eurofins eurofins

Email
Password
 
  
Forgot Password?
Create Account
 
 
  • Quick Order
  • 0

    Cart

  • Account
    • Login
    • Create Account
  • Produkte & Services
    • Oligonukleotid-Synthese
      • Produkte & Services
      • Oligonukleotid-Synthese
        • qPCR application oligos
        • PCR Primers
        • qPCR Probes
        • Ultimate Precision Probes
        • Next Generation Sequencing Oligos
        • NGSgrade Oligos
        • NGSgrade Oligos 2.0
        • NGS UDI Primer Sets
        • Sanger Sequencing Oligos
        • SeqPrimer
        • Standard Primers
        • Cloning applications & CRISPR
        • Cloning Oligo
        • EXTREmers
        • Custom DNA & RNA Oligos
        • Custom DNA Oligos
        • Salt Free Oligos
        • Custom RNA Oligos
        • siMAX siRNA
        • Large Scale Oligos
        • Spezialanfragen
        • Oligo Design Tools
        • Oligo Analysis Tool
        • PCR Primer Design Tool
        • qPCR Assay Design Tool
        • Sequencing Primer Design Tool
        • Hilfreiche Links
        • Oligo Decision Tree
        • Excel Upload Formulare Oligos

        • Prepaid Oligo Coupons
          Eine einzigartige Vorauszahlungsoption für PCR- und Sequenzier-Primer
          Mehr Erfahren

           

           

    • Gensynthese & Molekularbiologie
      • Produkte & Services
      • Gensynthese & Molekularbiologie
        • Synthetische Gene
        • Standard Gene
        • Express Gene
        • Complex Genes
        • Gensynthese Projekte
        • Gene Fragments
        • GeneStrands
        • Express GeneStrands
        • Genbibliotheken
        • Molekular Biologische Services
        • Plasmid Präparation
        • Ortsgerichtete Mutagenese (SDM)
        • DNA Klonierung
        • CRISPR/Cas9
        • Optimierungs-Tool
        • GENEius
    • Sanger Sequenzierung
      • Produkte & Services
      • Sanger Sequenzierung
        • Sequenzier-Services
        • Mix2Seq Service
        • LightRun Service
        • TubeSeq Supreme
        • PlateSeq Supreme
        • Direct Colony Sequencing
        • Prepaid-Produkte
        • Mix2Seq Kits
        • LightRun Barcodes
        • Barcode Labels & Coupons
        • PlateSeq Kits
        • Versandoptionen
        • Sequenzier-Accessories
        • Probenversand
        • Zusätzliche Services
        • Sequenzier-Primer
        • Kostenlose Barcode Labels
        • Spezielle Sequenzier-Services
        • Sequenzverifizierung und Primer Walking nach ISO 17025 & GLP
        • Mix2Seq Kit
          Schnellste Sanger-Sequenzierung von pre-mixed Proben in Tubes

          Jetzt Bestellen

           

           

    • Nanopore Sequenzierung
      • Produkte & Services
      • Nanopore Sequenzierung
        • ONT Lite Portfolio - Produkte
        • Whole Plasmid Sequencing
        • Klonale Amplikonsequenzierung
        • Genomsequenzierung von Bakterien
        • Genomsequenzierung von Hefen
        • Hybrid-Assemblierung von Bakterien
        • ONT Lite - Zusätzliche Services
        • Prepaid ONT Coupons
        • Kostenlose Barodes
        • ONT Lite Assembly Review
        • Genom-Sequenzierung (Projekte - ganze Flow Cells)
        • Human-Genomsequenzierung
        • Bakterien-Genomsequenzierung
        • Whole Genome Sequencing Non-Human
        • Amplikon-Sequenzierung (Projekte - ganze Flow Cells)
        • Custom Long-Read Amplicon Sequencing
        • 16S Volllängen-Mikrobiom
        • Prepaid ONT Lite Coupons
          Eine einzigartige "Pre-Payment"-Methode für Ihre Oxford Nanopore Sequenzierung

          Mehr erfahren

           

           

    • Next Generation Sequencing
      • Produkte & Services
      • Next Generation Sequencing
        • Genom-Sequenzierung
        • WGS Human
        • WGS Nicht-Human
        • INVIEW Resequencing
        • Human / Mammal WGS
        • Mikrobiom & Metagenom
        • INVIEW Microbiome
        • INVIEW Metagenome
        • Amplikon-Sequenzierung
        • Amplikon-Sequenzierung
        • Amplikon-Sequenzierung – Komplettservice
        • Transkriptom-Sequenzierung
        • INVIEW Transcriptome
        • INVIEW Transcriptome Bacteria
        • NGSelect RNA
        • Exome & Enrichment
        • INVIEW Exome
        • Clinical Research Exome
        • INVIEW Oncoprofiling
        • INVIEW Liquid Biopsy Oncoprofiling
        • Bioinformatische Services
        • RNA-Seq Analysis
        • Variant Analysis Service
        • Metagenome Analysis Service
        • Microbiome Profiling Analysis
        • Prepaid Coupons and free Barcodes
        • Free Barcodes
        • NGS Prepaid Coupons
        • Wichtige Informationen
        • Probenvorbereitung - Versand
        • Publikationen
        • Spezielle Anwendungen
        • INVIEW CRISPR Check
        • INVIEW Virus
        • Ready-to-Load
        • Prepaid NGS Coupons
          Eine einzigartige Vorauszahlungsoption für unsere NGS Services
          Mehr erfahren

           

           

    • Genotypisierung & Genexpression
      • Produkte & Services
      • Genotypisierung & Genexpression
        • Applied Genomic Services
        • DNA Barcoding
        • Zelllinienauthentifizierung
        • Mycoplasmacheck
        • Fragmentlängen-Analyse
        • Genotyping Services
        • SNP Genotypisierung
        • Copy Number Variation
        • Mikrosatellites/ STR/ FLA/ IDAA
        • Genexpression Services
        • Transkriptomanalyse
        • Expressionsarrays
        • Target Gene Expression
  • Märkte
    • Pharma / Biotech
      • Märkte
      • Pharma / Biotech
        • Syntheseprodukte
        • Industrie-optimierte NGS Oligos
        • Ultimate Precision Probes
        • Spezielle Oligo Anfragen
        • Large-Scale Oligos
        • Gensynthese
        • GeneStrands
        • Sequenzier-Services
        • Exome Sequencing
        • Transcriptome Sequencing
        • Genome Sequencing
        • Bioinformatic Solutions for NGS
        • Interessante Artikel (En)
        • NGS - Disease Diagnostics
        • Cancer Ecology
        • Personalised Cancer Therapy
        • Revolutionising human-like-protein production
        • The Microbiome Of Cancer
        • All about biomarker discovery
    • Agrigenomics
      • Märkte
      • Agrigenomics
        • Pflanzenzüchter
        • DNA marker discovery
        • Marker-assisted selection
        • GRAS-Di®
        • Microbiome and metagenomics
        • Tierzüchter
        • DNA Marker discovery
        • Pathogen screening
        • Parentage testing
        • Genomic selection
        • Marker-assisted selection
        • Webshop - GenFarmEval
        • Interessante Artikel (En)
        • Microarrays Accelerate Blue Biotechnology
        • How To Do NGS 50% Faster
        • NGS Portfolio
        • GenFarmEval.com

          Besuchen Sie den Online Shop direkt für Landwirte

          Merh erfahren (EN)

    • Consumer Genomics
      • Märkte
      • Consumer Genomics
        • Sequenzierung Services
        • Genotyping
        • Epigenome Profiling
        • Microbiome Analysis
        • Shotgun Sequencing
        • Whole Genome Sequencing
        • Ergänzende Services
        • Sample Collection Kits
        • Shipping
        • DNA Extraction
        • Laboratory Service
        • Biobanking
        • Interessante Artikel (En)
        • Population Genetics
        • The End of Gene Doping
        • Home Genomics Testing
        • IVDR Compliance
    • Nahrungsmittel und Umwelt
      • Märkte
      • Nahrungsmittel und Umwelt
        • Lebensmittel-Tests
        • Food Authenticity
        • Meat Traceability
        • Pathogen Traceability
        • Cannabis and Hemp Testing
        • Umwelt-Tests
        • Non-targeted detection of organisms / species
        • Targeted detection of organisms / species
        • eDNA Tracker
        • Interessante Artikel (En)
        • Determine the Source of Meat
        • Pine Nuts – Why Testing For Edibility Matters
    • Diagnostik Kit Produzenten
      • Märkte
      • Diagnostik Kit Produzenten
        • Syntheseprodukte
        • Large-Scale Oligos
        • Spezialanfragen für Oligos
        • Qualitätssicherung
        • GLP
        • ISO 17025
        • ISO 13485
        • Interessante Artikel (En)
        • Oligonucleotides For Diagnostics
        • The Future of RNA Applications
    • Forschung / Biotech
      • Märkte
      • Forschung / Biotech
        • Beliebte Services
        • Custom DNA Oligos
        • TubeSeq Service Sanger
        • INVIEW Microbiome NGS
        • NGS Services
        • GeneStrands
        • Express Services
        • Mix2Seq NightXpress
        • Express Genes
        • Express GeneStrands
        • Interessante Artikel (En)
        • Eurofins Genomics Goes Green
        • GENEius – Codon Usage Optimisation
        • 5 tips to speed up your qPCR
        • Why salt-free oligos are the unsung hero of molecular biology
  • Infos & Tools
    • Account
      • Infos & Tools
      • Account
        • Mein Profil
        • Bestellungen
        • Angebote
        • Gruppen
        • Einstellungen
        • Adressen
        • Dropboxen in der Nähe
        • Barcode Management
        • Sanger Kits & Barcodes
        • NGS Barcodes & Coupons
        • Genotyping Barcodes
        • Oligo Coupons
        • Primer / Cell Line Management
        • Sanger Proben & Primer
        • Zelllinien Management
    • Bezahloptionen
      • Infos & Tools
      • Bezahloptionen
        • EVOCARD Optionen
        • EVOcard Bezahlung
        • Neubestellung oder Aufladung EVOcard
    • Hilfe
      • Infos & Tools
      • Hilfe
        • Produkt FAQs
        • Video Anleitungen
        • GENEius
        • Excel Upload Formulare Oligos
        • Oligo Decision Tree
        • GATCViewer
    • Tools
      • Infos & Tools
      • Tools
        • Design Tools
        • PCR Primer Design Tool
        • Sequencing Primer Design Tool
        • Oligo Analyse Tool
  • Über uns
    • Über uns
      • Über uns
      • Über uns
        • Über Eurofins
        • Karriere
        • Distributoren
        • Neuigkeiten
        • Schließzeiten der Labore
        • Events
        • Impressum
    • Qualitätssicherung
      • Über uns
      • Qualitätssicherung
        • Qualitätssicherung
    • Angebote und Aktionen
      • Über uns
      • Angebote und Aktionen
        • Alle Angebote und Aktionen
        • Services Kostenlos Testen
        • EOY Angebote
  • Kontakt
Logo
  • Produkte & Services
    • Oligonukleotid-Synthese
      • Produkte & Services
      • Oligonukleotid-Synthese
        • qPCR application oligos
        • PCR Primers
        • qPCR Probes
        • Ultimate Precision Probes
        • Next Generation Sequencing Oligos
        • NGSgrade Oligos
        • NGSgrade Oligos 2.0
        • NGS UDI Primer Sets
        • Sanger Sequencing Oligos
        • SeqPrimer
        • Standard Primers
        • Cloning applications & CRISPR
        • Cloning Oligo
        • EXTREmers
        • Custom DNA & RNA Oligos
        • Custom DNA Oligos
        • Salt Free Oligos
        • Custom RNA Oligos
        • siMAX siRNA
        • Large Scale Oligos
        • Spezialanfragen
        • Oligo Design Tools
        • Oligo Analysis Tool
        • PCR Primer Design Tool
        • qPCR Assay Design Tool
        • Sequencing Primer Design Tool
        • Hilfreiche Links
        • Oligo Decision Tree
        • Excel Upload Formulare Oligos

        • Prepaid Oligo Coupons
          Eine einzigartige Vorauszahlungsoption für PCR- und Sequenzier-Primer
          Mehr Erfahren

           

           

    • Gensynthese & Molekularbiologie
      • Produkte & Services
      • Gensynthese & Molekularbiologie
        • Synthetische Gene
        • Standard Gene
        • Express Gene
        • Complex Genes
        • Gensynthese Projekte
        • Gene Fragments
        • GeneStrands
        • Express GeneStrands
        • Genbibliotheken
        • Molekular Biologische Services
        • Plasmid Präparation
        • Ortsgerichtete Mutagenese (SDM)
        • DNA Klonierung
        • CRISPR/Cas9
        • Optimierungs-Tool
        • GENEius
    • Sanger Sequenzierung
      • Produkte & Services
      • Sanger Sequenzierung
        • Sequenzier-Services
        • Mix2Seq Service
        • LightRun Service
        • TubeSeq Supreme
        • PlateSeq Supreme
        • Direct Colony Sequencing
        • Prepaid-Produkte
        • Mix2Seq Kits
        • LightRun Barcodes
        • Barcode Labels & Coupons
        • PlateSeq Kits
        • Versandoptionen
        • Sequenzier-Accessories
        • Probenversand
        • Zusätzliche Services
        • Sequenzier-Primer
        • Kostenlose Barcode Labels
        • Spezielle Sequenzier-Services
        • Sequenzverifizierung und Primer Walking nach ISO 17025 & GLP
        • Mix2Seq Kit
          Schnellste Sanger-Sequenzierung von pre-mixed Proben in Tubes

          Jetzt Bestellen

           

           

    • Nanopore Sequenzierung
      • Produkte & Services
      • Nanopore Sequenzierung
        • ONT Lite Portfolio - Produkte
        • Whole Plasmid Sequencing
        • Klonale Amplikonsequenzierung
        • Genomsequenzierung von Bakterien
        • Genomsequenzierung von Hefen
        • Hybrid-Assemblierung von Bakterien
        • ONT Lite - Zusätzliche Services
        • Prepaid ONT Coupons
        • Kostenlose Barodes
        • ONT Lite Assembly Review
        • Genom-Sequenzierung (Projekte - ganze Flow Cells)
        • Human-Genomsequenzierung
        • Bakterien-Genomsequenzierung
        • Whole Genome Sequencing Non-Human
        • Amplikon-Sequenzierung (Projekte - ganze Flow Cells)
        • Custom Long-Read Amplicon Sequencing
        • 16S Volllängen-Mikrobiom
        • Prepaid ONT Lite Coupons
          Eine einzigartige "Pre-Payment"-Methode für Ihre Oxford Nanopore Sequenzierung

          Mehr erfahren

           

           

    • Next Generation Sequencing
      • Produkte & Services
      • Next Generation Sequencing
        • Genom-Sequenzierung
        • WGS Human
        • WGS Nicht-Human
        • INVIEW Resequencing
        • Human / Mammal WGS
        • Mikrobiom & Metagenom
        • INVIEW Microbiome
        • INVIEW Metagenome
        • Amplikon-Sequenzierung
        • Amplikon-Sequenzierung
        • Amplikon-Sequenzierung – Komplettservice
        • Transkriptom-Sequenzierung
        • INVIEW Transcriptome
        • INVIEW Transcriptome Bacteria
        • NGSelect RNA
        • Exome & Enrichment
        • INVIEW Exome
        • Clinical Research Exome
        • INVIEW Oncoprofiling
        • INVIEW Liquid Biopsy Oncoprofiling
        • Bioinformatische Services
        • RNA-Seq Analysis
        • Variant Analysis Service
        • Metagenome Analysis Service
        • Microbiome Profiling Analysis
        • Prepaid Coupons and free Barcodes
        • Free Barcodes
        • NGS Prepaid Coupons
        • Wichtige Informationen
        • Probenvorbereitung - Versand
        • Publikationen
        • Spezielle Anwendungen
        • INVIEW CRISPR Check
        • INVIEW Virus
        • Ready-to-Load
        • Prepaid NGS Coupons
          Eine einzigartige Vorauszahlungsoption für unsere NGS Services
          Mehr erfahren

           

           

    • Genotypisierung & Genexpression
      • Produkte & Services
      • Genotypisierung & Genexpression
        • Applied Genomic Services
        • DNA Barcoding
        • Zelllinienauthentifizierung
        • Mycoplasmacheck
        • Fragmentlängen-Analyse
        • Genotyping Services
        • SNP Genotypisierung
        • Copy Number Variation
        • Mikrosatellites/ STR/ FLA/ IDAA
        • Genexpression Services
        • Transkriptomanalyse
        • Expressionsarrays
        • Target Gene Expression
  • Märkte
    • Pharma / Biotech
      • Märkte
      • Pharma / Biotech
        • Syntheseprodukte
        • Industrie-optimierte NGS Oligos
        • Ultimate Precision Probes
        • Spezielle Oligo Anfragen
        • Large-Scale Oligos
        • Gensynthese
        • GeneStrands
        • Sequenzier-Services
        • Exome Sequencing
        • Transcriptome Sequencing
        • Genome Sequencing
        • Bioinformatic Solutions for NGS
        • Interessante Artikel (En)
        • NGS - Disease Diagnostics
        • Cancer Ecology
        • Personalised Cancer Therapy
        • Revolutionising human-like-protein production
        • The Microbiome Of Cancer
        • All about biomarker discovery
    • Agrigenomics
      • Märkte
      • Agrigenomics
        • Pflanzenzüchter
        • DNA marker discovery
        • Marker-assisted selection
        • GRAS-Di®
        • Microbiome and metagenomics
        • Tierzüchter
        • DNA Marker discovery
        • Pathogen screening
        • Parentage testing
        • Genomic selection
        • Marker-assisted selection
        • Webshop - GenFarmEval
        • Interessante Artikel (En)
        • Microarrays Accelerate Blue Biotechnology
        • How To Do NGS 50% Faster
        • NGS Portfolio
        • GenFarmEval.com

          Besuchen Sie den Online Shop direkt für Landwirte

          Merh erfahren (EN)

    • Consumer Genomics
      • Märkte
      • Consumer Genomics
        • Sequenzierung Services
        • Genotyping
        • Epigenome Profiling
        • Microbiome Analysis
        • Shotgun Sequencing
        • Whole Genome Sequencing
        • Ergänzende Services
        • Sample Collection Kits
        • Shipping
        • DNA Extraction
        • Laboratory Service
        • Biobanking
        • Interessante Artikel (En)
        • Population Genetics
        • The End of Gene Doping
        • Home Genomics Testing
        • IVDR Compliance
    • Nahrungsmittel und Umwelt
      • Märkte
      • Nahrungsmittel und Umwelt
        • Lebensmittel-Tests
        • Food Authenticity
        • Meat Traceability
        • Pathogen Traceability
        • Cannabis and Hemp Testing
        • Umwelt-Tests
        • Non-targeted detection of organisms / species
        • Targeted detection of organisms / species
        • eDNA Tracker
        • Interessante Artikel (En)
        • Determine the Source of Meat
        • Pine Nuts – Why Testing For Edibility Matters
    • Diagnostik Kit Produzenten
      • Märkte
      • Diagnostik Kit Produzenten
        • Syntheseprodukte
        • Large-Scale Oligos
        • Spezialanfragen für Oligos
        • Qualitätssicherung
        • GLP
        • ISO 17025
        • ISO 13485
        • Interessante Artikel (En)
        • Oligonucleotides For Diagnostics
        • The Future of RNA Applications
    • Forschung / Biotech
      • Märkte
      • Forschung / Biotech
        • Beliebte Services
        • Custom DNA Oligos
        • TubeSeq Service Sanger
        • INVIEW Microbiome NGS
        • NGS Services
        • GeneStrands
        • Express Services
        • Mix2Seq NightXpress
        • Express Genes
        • Express GeneStrands
        • Interessante Artikel (En)
        • Eurofins Genomics Goes Green
        • GENEius – Codon Usage Optimisation
        • 5 tips to speed up your qPCR
        • Why salt-free oligos are the unsung hero of molecular biology
  • Infos & Tools
    • Account
      • Infos & Tools
      • Account
        • Mein Profil
        • Bestellungen
        • Angebote
        • Gruppen
        • Einstellungen
        • Adressen
        • Dropboxen in der Nähe
        • Barcode Management
        • Sanger Kits & Barcodes
        • NGS Barcodes & Coupons
        • Genotyping Barcodes
        • Oligo Coupons
        • Primer / Cell Line Management
        • Sanger Proben & Primer
        • Zelllinien Management
    • Bezahloptionen
      • Infos & Tools
      • Bezahloptionen
        • EVOCARD Optionen
        • EVOcard Bezahlung
        • Neubestellung oder Aufladung EVOcard
    • Hilfe
      • Infos & Tools
      • Hilfe
        • Produkt FAQs
        • Video Anleitungen
        • GENEius
        • Excel Upload Formulare Oligos
        • Oligo Decision Tree
        • GATCViewer
    • Tools
      • Infos & Tools
      • Tools
        • Design Tools
        • PCR Primer Design Tool
        • Sequencing Primer Design Tool
        • Oligo Analyse Tool
  • Über uns
    • Über uns
      • Über uns
      • Über uns
        • Über Eurofins
        • Karriere
        • Distributoren
        • Neuigkeiten
        • Schließzeiten der Labore
        • Events
        • Impressum
    • Qualitätssicherung
      • Über uns
      • Qualitätssicherung
        • Qualitätssicherung
    • Angebote und Aktionen
      • Über uns
      • Angebote und Aktionen
        • Alle Angebote und Aktionen
        • Services Kostenlos Testen
        • EOY Angebote
  • Kontakt
Login | Create Account
 

Gene Synthesis

  Intro & Info

Welcome to our Gene Synthesis order platform.

How to enter your gene details:
  • Select the entry format of your gene name and gene sequence:
    • Single input: Select the number of genes and enter the information later directly on the page
    • Copy&Paste: if you have a copy ready format of all your genes you can easily paste them in here
    • File-Upload: use our Excel template to upload your sequences and names.
  • Additional Options:
    • Here you need to define all properties for your genes: optimisation required, restriction sites, subcloning vectors and plasmid preparation scale
  • Sequence validation:
    • For customers using "Single input" you now need to add your gene sequence
    • For all other entry formats the gene sequences are displayed here.
    • All sequences will now be checked for complexities and in case of codon optimisation it will directly be optimised
  • Summary & Review:
    • If your genes apply for "Express Genes" you can select here the express production times. In addition you can download a summary of your gene order.

The gene synthesis wizard is able to manage all kind of genes: Standard, Complex and Express Genes.

Using Templates:
  • If you order genes on a regular basis you can save your "additional options" as template and simply select the correct template.
  • You can add several templates to ensure that you have one template for each gene category you need.

Email notification for gene optimisation:
If you are logged in while entering your gene order you don't need to wait for GENEius to optimise your sequence. Our system will do that for you in the background and inform you via Email when the optimisation is successfully performed. The order will automatically be placed in your cart.

Risk group classification sheet

For gene synthesis orders including subcloning please download the risk group classification sheet and send the filled form to genes-eu[at]genomics.eurofinseu.com after placing your order.
 
  • Entry Format
  • Additional Options
  • Sequence Validation
  • Summary & Review
 

Entry Formats



Number of genes:
 
Please select the number of genes you want to order and press "Next".
You can always add more or leave lines empty on the next page.
 
 
Gene sequences can be DNA or Amino Acid. Name and sequence can be separated by a blank, tab, comma or semicolon:

Gene1[blank]TACGACGGAGTGTTATAAGATGGGAAATCGGATACCAGATGAAATTG
Gene2[TAB]TACGACGGAGTGTTATAAGATGGGAAATCGGATACCAGATGAAATTGTG
Gene3,FTGSNVEDRSSSGSWGNGGHPSPSRNYGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKSQY
Gene4;SWGNGGHPSPSRNYGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTSYSSYGRESN

XLS Icon Download our Excel template for uploading your genes.
Allowed file formats are xls, xlsx and csv. The file needs two columns named name and sequence without a special format.
 
 
 
Define your genes by using our Excel template above. Upload your file and press "Next".
 
 
Next
 
Contact Us

TECHNICAL SUPPORT

Phone: +49 (8092) 3379800

Toll Free Phone Number: 00800-200 100 20

E-Mail: support-eu@genomics.eurofinseu.com

HOURS

Mon-Thu: 8 : 00 AM – 5 : 00 PM, ET

Friday: 8 : 00 AM – 4 : 00 PM, ET

QUOTES, PRICING & SPECIAL REQUESTS

Quotes are submitted, reviewed, and accepted through the online quoting tool. Learn more.
Please direct inquires about pricing and special project requests to your sales representative.
General questions: support-eu@genomics.eurofinseu.com

Change Region

  • Europe (current website)
  • America
  • India
  • Japan

We love hearing from our customers. Feel free to leave feedback.

Submit Feedback
Careers
  • ISO 9001
  • ISO 13485
  • ISO 17025

2025 - Copyright Eurofins Genomics

  • Terms & Conditions
  • Corporate
  • Privacy
  • Impressum
VEGA Beta