Gene Synthesis
progress bar
progress bar

Häufig gestellte Fragen
Kontaktieren Sie uns
Newsletter abonnieren
w10.0.14 | c2.0.0.16
PROD | u7.5.14
  Quick Order  0
Ecom-Admin
  • Markets
  • Products
  • Company
  • Contact
  • EN
  • Oligonucleotide Synthesis
  • Gene Synthesis & Molecular Biology
  • Sanger Sequencing
  • Next Generation Sequencing
  • Genotyping & Gene Expression

Further Information:

>> EVOcard

>> Product FAQs

>> SALE %

Application Oligos

  • qPCR Probes
  • PCR Primer
  • SeqPrimer
  • Cloning Oligos
  • NGSgrade Oligos
>> Show more

Custom Oligos

  • Custom DNA Oligos
  • Large Scale Oligos
  • Custom RNA Oligos
  • Special Requests
>> Show more

Oligo Tools

  • Oligo Analysis Tool
  • Primer Design Tools
  • qPCR Assay Design Tools
  • siRNA Design Tool
>> Show more

Benefit from more than 25 years of experience in oligonucleotide synthesis!

>> Show all products

Gene Synthesis

  • Standard Genes
  • Express Gene
  • Gene Synthesis Project
  • GENEius
>> Show more

GeneStrands

  • GeneStrands
  • Express GeneStrands

Molecular Biology Services

  • Plasmid Preparation
  • CRISPR/Cas9
>> Show more

Optimise your research and save time with high quality gene synthesis and molecular biology services.

>> Show all products

Eurofins Services

  • Mix2Seq
  • TubeSeq Service
  • PlateSeq Service
  • Direct Colony Sequencing
>> Show more

GATC Services

  • LightRun Tube
  • LightRun Plate
  • SupremeRun Tube
  • SupremeRun Plate
>> Show more

Additional Services

  • Sequencing Projects
  • Sequencing Primers
  • Sequencing Accessories
  • Sample Shipment
>> Show more

Hiqh quality Sanger sequencing with highest flexibility for every sample type.

>> Show all products

Top 5 Products

  • INVIEW Resequencing
  • INVIEW Microbiome
  • INVIEW Transcriptome
  • INVIEW Metagenome
  • NGSelect Amplicon
>> Show more

Spotlight

  • INVIEW Exome
  • INVIEW Virus
  • INVIEW Plasmid Verification
  • INVIEW CRISPR Check
  • NGS Prepaid Coupons
>> Show more

Special Applications

  • Genome Sequencing
  • ARTIC SARS-CoV 2 RNA-Seq
  • Oncology Solutions
>> Show more

NGS from experts - ISO-certified, fully automated and easy to order online.

>> Show all products

Applied Genomic Services

  • DNA Barcoding
  • Cell Line Authentication
  • Mycoplasmacheck
  • Fragment Length Analysis
>> Show more

Genotyping services

  • SNP Genotyping
  • Copy Number Variation
  • Mikrosatellites/ STR/FLA/ IDAA
>> Show more

Gene Expression Services

  • Transcriptome analysis
  • Expression Arrays
  • Target Gene Expression
>> Show more

Cell line authentication, Mycoplasmacheck, Fragment length analysis & tailored projects.

>> Show all products

Pharma/Biotech

Our genomics solutions support you along your drug development chain of small and large molecules and in precision medicine.


Oncology solutions from experts in FFPE and liquid biopsies. Learn more >>

>> Show more

Agrigenomics

Benefit from our range of tailored, high throughput genotyping solutions to help you achieve your goals faster, for less.

>> Show more

Consumer Genomics

Welcome to your full-service laboratory. Benefit from our end-to end solutions for sample collection kit logistics and genomic solutions.

>> Show more

Food & Environment

DNA-based solutions to improve and support your analysis, monitoring and traceability across your value chain.


Special solutions for biodiversity monitoring and environmental DNA analysis Learn more >>

>> Show more

Diagnostic Kit Producer

Our scalable and high-quality oligonucleotides synthesis offer makes us an ideal partner for your industry applications

>> Show more

Research

For your research project in academic, governmental and industrial environment we have the right genomic service.

>> Show more

Corporate Information

  • About us
  • Career
  • Events
  • Press Releases
  • Collaborations
  • Blog
  • Newsletter
  • Quality Assurance
  • Lab closure times

Help

  • Video Tutorials
  • Ordering
  • Payment
  • Shipping & Delivery
  • Downloads
  • Data & Privacy
  • Material and Methods

 

Contact us

Eurofins Genomics
Germany GmbH
Anzinger Str. 7a
85560 Ebersberg
Germany

  • phone +49 7531 816068
  • e-mail support

Get in touch with us!

You need support or advice with your order? You don't find the perfect product or you like to get consultation regarding your results?

>> Get in touch

Find your product

Find your product

  • Sequencing Primer
  • PCR Primer
  • Mycoplasmacheck
  • SALE %
  • TubeSeq

Login to Eurofins

Please login with your email address and password!

>> Login

New at Eurofins Genomics?

Register a new account at Eurofins Genomics!

>> Register
Impersonating: Max Mustermann

Administration

  • Ecom Admin
  • Stop Impersonating

Welcome

Julian Schlossmacher

Login / Register

 
Email
Password:
Forgot password?
Create Account
No SSL
>> Logout >> My profile

Contact

Dr. Melvin Siliakus

+31 629 39 25 66 >> Send message

Account

  • Overview
  • Orders
  • Quotes
  • EVOcards
  • Preferences
  • DropBoxes
  • Sanger Kits & Barcodes
  • NGS Barcodes & Coupons
  • Samples & Primers @ Eurofins
  • Samples & Primers @ GATC

Language

model-logo

New Website Navigation explained

>> Close
6

Last added items

0 Item(s)

Go to Cart

>> Go to cart X
 

Quick Order

X

EVOcard

Order / Refill EVOcard

Oligonucleotide Synthesis

Primers & Probes for qPCR Applications

  • PCR Primer in Tubes
  • PCR Primer NightXpress
  • PCR Primer in Plates
  • LocNA Primer
  • Dual Labeled Probes
  • MGB Probes
  • LocNA Probe
  • Molecular Beacons
  • LightCycler Probes
  • Probe based qPCR Assay

Oligos for Next Generation Sequencing

  • NGSgrade Oligos in Tubes
  • NGSgrade Oligos in Plates
  • NGS Adaptor Lig. Oligos
  • NGS 2nd PCR Oligos
  • NGS UDI Primer Sets

Primers for Sanger Sequencing

  • SeqPrimer in Tubes
  • SeqPrimer NightXpress
  • SeqPrimer in Plates
  • Standard Primer

Oligos for Cloning Applications

  • Cloning Oligos
  • EXTREmer Oligos

Custom Oligos

  • Custom DNA Oligos in Tube
  • SaltFree Oligo NightXpress
  • Custom DNA Oligos in Plates
  • Nano-Scale Plate Oligos
  • Custom RNA Oligos
  • O-Methyl-RNA / Chimerics
  • RNA qPCR Probes
  • siMAX siRNA
  • Large Scale Oligos
  • Special Oligos in Tubes

Oligo Tools

  • Oligo Analysis Tool
  • PCR Primer Design
  • qPCR Assay Design
  • SeqPrimer Design
  • siMAX siRNA Design
  • Scaffold DNA

Gene Synthesis & Molecular Biology

Synthetic genes

  • Gene Synthesis
  • Combinatorial libraries
  • Gene Synthesis Projects

GeneStrands

  • GeneStrands
  • Express GeneStrands

Molecular Biology Services

  • Plasmid Preparation
  • Corona Control Plasmids
  • Site Directed Mutagenesis
  • DNA Cloning Service

Sanger Sequencing

Eurofins Services

  • TubeSeq Service
  • TubeSeq Labels & Coupons
  • PlateSeq Service
  • PlateSeq Kits
  • Mix2Seq Kits
  • Direct Colony Sequencing
  • Ready2Load Tube
  • Ready2Load Plate

GATC Services

  • SupremeRun Tube
  • SupremeRun Barcodes
  • SupremeRun 96
  • LightRun Barcodes

Sequencing Projects

  • Primer Walking
  • 16S / ITS Sequencing
  • Re-Sequencing Projects
  • TOPO-TA Cloning
  • Re-Sequencing under GLP
  • Primer Walking under GLP

Additional Services

  • Tube & Plate Barcode Labels
  • Sequencing Accessories
  • Sample Shipment
  • Sequencing Primer Design

Next Generation Sequencing

Genome Sequencing

  • INVIEW Resequencing
  • NGSelect DNA
  • Whole Genome Sequencing

Transcriptome Sequencing

  • INVIEW Transcriptome
  • NGSelect RNA

Metagenome / Microbiome

  • INVIEW Microbiome
  • INVIEW Metagenome

Exome Sequencing & Oncology Solutions

  • INVIEW Human Exome
  • Liquid Biopsy Samples
  • INVIEW Oncoprofiling

CRISPR & Prepaid NGS Coupons

  • INVIEW CRISPR Check
  • Redeem NGS Coupons
  • Order NGS Coupons

VIRUS

  • INVIEW Virus
  • SARS-CoV-2 (Corona virus)

Plasmid Sequencing

  • INVIEW Plasmid Verification

Amplicon sequencing & Ready-to-Load

  • NGSelect Amplicon
  • NGSelect Ready-to-Load

Additional Services

  • NGS Barcodes & UPS labels
  • NGS Additional Services
  • Sample Submission Guidelines
  • Prepaid NGS Coupons
  • Replacement samples
  • Request for Information

Genotyping & Gene Expression

Mycoplasmacheck

  • Mycoplasmacheck Barcodes
  • Mycoplasmacheck results

CLA & FLA

  • Cell line authentication Service (CLA)
  • Fragment length Analysis (FLA)
  • Cell line authentication barcodes

Others

  • Genotyping request form

Login / Register

 
Email
Password:
Forgot password?
Create Account
No SSL

 

  • Order Menu

    EVOcards

    • EVOcard bestellen / aufladen

    Oligonucleotides & siRNA

    • (q)PCR Primer in Tubes
    • (q)PCR Primer in Platte
    • (q)PCR Primer NightXpress
    • SeqPrimer in Tubes
    • SeqPrimer in Platte
    • SeqPrimer NightXpress
    • Custom DNA Oligos in Tubes
    • Custom DNA Oligos in Platte
    • SaltFree Oligo NightXpress
    • NGSgrade Oligos in Tubes
    • Standard Primer
    • Standard Primer NightXpress
    • LocNA Primer
    • LocNA Probes
    • Dual Labeled Probes
    • MGB Probes
    • Probe based qPCR Assay
    • Cloning Oligos in Tubes
    • EXTREmer Oligos
    • Nano-Scale Plate Oligos
    • NGS UDI Primer Sets
    • Custom RNA Oligos
    • RNA qPCR Probes
    • siMAX siRNA
    • Large Scale Oligos
    • Spezialanfragen
    • Mehr...

    Custom DNA Sequencing

    • Mix2Seq Kits
    • LightRun Barcodes
    • Sequenzier-Primer
    • TubeSeq Service
    • SupremeRun Tube
    • Tube & Platten Barcode Labels
    • TubeSeq Labels & Coupons
    • SupremeRun Barcodes
    • Sequenzier-Accessories
    • PlateSeq Kits
    • SupremeRun 96
    • Primer Walking
    • PlateSeq Service
    • SupremeRun | Multiprimer
    • Sequenzierprojekte
    • Direct Colony Sequencing
    • Ready2Load Plate
    • Mehr...

    Next Generation Sequencing

    • INVIEW Microbiom Profiling
    • NGSelect DNA
    • Barcode & UPS Labels
    • INVIEW Transcriptome
    • NGSelect RNA
    • Angebotsanfrage
    • INVIEW Exom
    • NGSelect Amplikon
    • Ersatzproben
    • INVIEW Resequencing
    • NGSelect Amplicon 2nd PCR
    • Probenvorbereitung
    • INVIEW CRISPR Check
    • Coupons einlösen
    • Mehr ...
    • INVIEW Oncopanel
    • SARS-CoV-2 RNA-Seq

    Gene Synthesis & Molecular Biology

    • Gen-Bestellseite
    • Plasmid Präparation
    • GeneStrands
    • Express Gene
    • DNA Klonierung
    • Genbibliotheken
    • Gensynthese Projekte
    • Ortsgerichtete Mutagenese
    • Express GeneStrands
    • Corona Kontrollplasmide

    Genotyping & Gene Expression

    • Zelllinienauthentifizierung
    • Mycoplasmacheck
    • Fragmentlängen-Analyse
    • Zelllinien-Barcodes
    • Angebotsanfrage

0 Item(s)

Go to Cart

  • DNA & RNA
    Oligonucleotides
    • >

      Optimised Application Oligos

    • >
      qPCR Probes
    • >
      PCR Primers
    • >
      SeqPrimer
    • >
      Cloning Oligo
    • >
      EXTREmers
    • >
      NGSgrade Oligos
    • >

      Custom DNA & RNA Oligos

    • >
      Custom DNA Oligos
    • >
      Large-Scale Oligos
    • >
      Custom RNA Oligos
    • >
      siMAX siRNA
    • >
      Spezialanfragen
    • >

      Oligo Tools

    • >
      Oligo Analyse Tool
    • >
      Primer Design Tools
    • >
      qPCR Assay Design Tools
    • >
      siRNA Design Tool
  • Custom DNA
    Sequencing
    • >

      Eurofins Services

    • >
      Mix2Seq
    • >
      Mix2Seq Kits
    • >
      TubeSeq Service
    • >
      TubeSeq Labels & Coupons
    • >
      PlateSeq Service
    • >
      PlateSeq Kits
    • >
      Ready2Load Service
    • >
      Direct Colony Sequencing
    • >
      Sequenzierprojekte
    • >

      GATC Services

    • >
      LightRun Tube
    • >
      LightRun Plate
    • >
      LightRun Barcodes
    • >
      SupremeRun Tube
    • >
      SupremeRun Plate
    • >
      SupremeRun Barcodes
    • >

      Zusätzliche Services

    • >
      Tube & Platten Barcode Labels
    • >
      Sequenzier-Primer
    • >
      Sequenzier-Accessories
    • >
      Probenversand
    • >
      Kostenlose Probenabholung
  • Next Generation Sequencing
    • >

      NGS Built For You

    • >
      INVIEW Genome
    • >
      INVIEW Microbiome
    • >
      INVIEW Metagenome
    • >
      INVIEW Transcriptome
    • >
      INVIEW Exome
    • >
      INVIEW CRISPR Check
    • >
      INVIEW Virus
    • >
      NGS Prepaid Coupons
    • >
      INVIEW Plasmid Verification
    • >

      NGS Build Your Own

    • >
      NGSelect DNA
    • >
      NGSelect RNA
    • >
      NGSelect Amplikon
    • >
      NGSelect Ready2Load
    • >

      NGS Projekte

    • >
      Genom-Sequenzierung
    • >
      Transkriptom Sequenzierung
    • >
      Resequenzierung & Amplikons
    • >
      Bioinformatiklösungen
    • >

      Anwendungen

    • >
      SARS-CoV 2 Genomsequenzierung
    • >
      Artic SARS-CoV 2 RNA-Seq
    • >
      Onkologie Lösungen
  • Gensynthese & Molekularbiologie
    • >

      Gensynthese

    • >
      Standard Gene
    • >
      Express Gene
    • >
      Komplexe Gene
    • >
      Genbibliotheken
    • >
      GeneStrands
    • >
      Express GeneStrands
    • >
      Gene im neuen Shop
    • >

      GENEius

    • >
      Sequenzoptimierung
    • >
      Codon Usage Anpassung
    • >
      GENEius Und Ecom
    • >

      Molekularbiologische Services

    • >
      Plasmid Präparation
    • >
      Ortsgerichtete Mutagenese
    • >

      Anwendungen

    • >
      CRISPR/Cas9
    • >
      Corona Kontrollplasmide
    • >
      SARS-CoV-2 ELISA Kits
  • Genotypisierung & Genexpression
    • >

      Service Plattformen

    • >
      Illumina Array Plattformen
    • >
      Affymetrix Array Plattformen
    • >
      Fluidigm BioMark & EP1
    • >
      Roche LightCycler
    • >
      Sanger Sequenzierung & NGS
    • >

      Genotypisierung Services

    • >
      SNP Genotypisierung
    • >
      Mikrosatelliten / STR / FLA / IDAA
    • >
      Mittels Sequenzierung
    • >
      Genotypisierung mittels PCR
    • >
      Genom-weite Assoziationen
    • >
      Humanidentifizierung
    • >
      Copy Number Variation
    • >

      Genexpression Services

    • >
      Transkriptomanalyse
    • >
      Expressionsarrays
    • >
      Target Gene Expression
    • >
      miRNA / small RNA Analyse
    • >

      Applied Genomics Services

    • >
      Residual DNA Nachweis
    • >
      DNA Barcoding
    • >
      Zelllinienauthentifizierung
    • >
      Mycoplasmacheck
 

Gene Synthesis

  Intro & Info

Welcome to our Gene Synthesis order platform.

How to enter your gene details:
  • Select the entry format of your gene name and gene sequence:
    • Single input: Select the number of genes and enter the information later directly on the page
    • Copy&Paste: if you have a copy ready format of all your genes you can easily paste them in here
    • File-Upload: use our Excel template to upload your sequences and names.
  • Additional Options:
    • Here you need to define all properties for your genes: optimisation required, restriction sites, subcloning vectors and plasmid preparation scale
  • Sequence validation:
    • For customers using "Single input" you now need to add your gene sequence
    • For all other entry formats the gene sequences are displayed here.
    • All sequences will now be checked for complexities and in case of codon optimisation it will directly be optimised
  • Summary & Review:
    • If your genes apply for "Express Genes" you can select here the express production times. In addition you can download a summary of your gene order.

The gene synthesis wizard is able to manage all kind of genes: Standard, Complex and Express Genes.

Using Templates:
  • If you order genes on a regular basis you can save your "additional options" as template and simply select the correct template.
  • You can add several templates to ensure that you have one template for each gene category you need.

Email notification for gene optimisation:
If you are logged in while entering your gene order you don't need to wait for GENEius to optimise your sequence. Our system will do that for you in the background and inform you via Email when the optimisation is successfully performed. The order will automatically be placed in your cart.
 
  • Entry Format
  • Additional Options
  • Sequence Validation
  • Summary & Review
 

Entry Formats



Number of genes:
 
Please select the number of genes you want to order and press "Next".
You can always add more or leave lines empty on the next page.
 
 
Gene sequences can be DNA or Amino Acid. Name and sequence can be separated by a blank, tab, comma or semicolon:

Gene1[blank]TACGACGGAGTGTTATAAGATGGGAAATCGGATACCAGATGAAATTG
Gene2[TAB]TACGACGGAGTGTTATAAGATGGGAAATCGGATACCAGATGAAATTGTG
Gene3,FTGSNVEDRSSSGSWGNGGHPSPSRNYGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKSQY
Gene4;SWGNGGHPSPSRNYGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTSYSSYGRESN

XLS Icon Download our Excel template for uploading your genes.
Allowed file formats are xls, xlsx and csv. The file needs two columns named name and sequence without a special format.
 
 
 
Define your genes by using our Excel template above. Upload your file and press "Next".
 
 
Next
 
Production Site
  • Europe
  • America
  • India
  • Japan
Eurofins Genomics
  • Terms & Conditions
  • Sitemap
  • Imprint
  • Privacy
  • Licenses
  • Cookie Settings
Contact
General Customer Support
phone +49 7531 816068
Toll free phone number for
Europe: 00800 200 100 20
support-eu@genomics.eurofinseu.com

Eurofins Genomics
Germany GmbH
Anzinger Str. 7a
85560 Ebersberg
Germany

/p>

2023 - Eurofins Genomics

VEGA Beta