Super Express Genes Group B
progress bar
progress bar

Häufig gestellte Fragen
Kontaktieren Sie uns
Newsletter abonnieren
w10.0.14 | c1.25.03.1
PROD | u7.5.14
  Quick Order  0
Ecom-Admin
  • Markets
  • Products
  • Company
  • Contact
  • EN
  • Oligonucleotide Synthesis
  • Gene Synthesis & Molecular Biology
  • Sanger Sequencing
  • Next Generation Sequencing
  • Genotyping & Gene Expression

Further Information:

>> EVOcard

>> Product FAQs

>> SALE %

Application Oligos

  • qPCR Probes
  • Ultimate Precision Probes
  • PCR Primer
  • SeqPrimer
  • Cloning Oligos
  • NGSgrade Oligos 2.0
  • NGSgrade Oligos
  • NGS UDI Primer Sets
>> Show more

Custom Oligos

  • Custom DNA Oligos
  • Salt-Free Oligos
  • Large Scale Oligos
  • Custom RNA Oligos
  • Special Requests
>> Show more

Oligo Tools

  • Oligo Analysis Tool
  • PCR Primer Design Tool
  • Sequencing Primer Design Tool
  • qPCR Assay Design Tool
  • siRNA Design Tool
  • Prepaid Oligo Coupons
  • Excel Order Forms
>> Show more

Benefit from more than 25 years of experience in oligonucleotide synthesis!

>> Show all products

Gene Synthesis

  • Standard Genes
  • Express Gene
  • Gene Synthesis Project
  • GENEius
>> Show more

GeneStrands

  • GeneStrands
  • Express GeneStrands

Molecular Biology Services

  • Plasmid Preparation
  • CRISPR/Cas9
>> Show more

Optimise your research and save time with high quality gene synthesis and molecular biology services.

>> Show all products

Sequencing Services

  • Mix2Seq Service
  • LightRun Services
  • TubeSeq Supreme
  • PlateSeq Supreme
  • Direct Colony Sequencing
  • Whole Plasmid Sequencing
  • Primer Walking Service
>> Show more

Prepaid Products

  • Mix2Seq Kits
  • LightRun Barcodes
  • Barcode Labels & Coupons
  • PlateSeq Kits
  • PlateSeq Kit Colony
  • ONT Prepaid Coupons
>> Show more

Additional Services

  • Free Barcode Labels
  • Sequencing Accessories
  • Sequencing Primers
  • Sample Shipment
>> Show more

Hiqh quality Sanger sequencing with highest flexibility for every sample type.

>> Show all products

Top 5 Products

  • INVIEW Resequencing
  • INVIEW Microbiome
  • INVIEW Transcriptome
  • INVIEW Metagenome
  • Amplicon sequencing
  • Bioinformatic services
  • Genome sequencing
>> Show more

Spotlight

  • INVIEW Exome
  • INVIEW Virus
  • INVIEW CRISPR Check
  • NGS Prepaid Coupons
  • Oncology Solutions
  • OLINK Explore 3072
  • Clinical Research Exome
  • Bacteria Hybrid Assembly
>> Show more

Oxford Nanopore Products

  • Whole Plasmid Sequencing
  • Linear / Clonal Amplicons
  • Bacterial Genome Sequencing
  • 16S Full-Length Microbiome
  • Complete ONT Portfolio
>> Show more

NGS from experts - ISO-certified, fully automated and easy to order online.

>> Show all products

Applied Genomic Services

  • DNA Barcoding
  • Cell Line Authentication
  • Mycoplasmacheck
  • Fragment Length Analysis
>> Show more

Genotyping services

  • SNP Genotyping
  • Copy Number Variation
  • Mikrosatellites/ STR/FLA/ IDAA
>> Show more

Gene Expression Services

  • Transcriptome analysis
  • Expression Arrays
  • Target Gene Expression
>> Show more

Cell line authentication, Mycoplasmacheck, Fragment length analysis & tailored projects.

>> Show all products
  • Pharma / Biotech
  • Agrigenomics
  • Consumer Genomics
  • Food & Environment
  • Diagnostic Kit Producer
  • Research / Biotech

Further Information:

>> Quality

>> Events

Synthesis Products

  • Industrial-grade NGS Oligos
  • Ultimate Precision Probes
  • Special Oligo Requests
  • Large Scale Oligos
  • Gene Synthesis
  • GeneStrands
  • Plasmid Preparation

Sequencing Services

  • Amplicon Sequencing
  • Exome Sequencing
  • Transcriptome Sequencing
  • Primer Walking Service

Favorite Content

  • NGS – Disease Diagnostics
  • Cancer Ecology
  • Personalised Cancer Therapy
  • Revolutionising human-like-protein production
  • The Microbiome Of Cancer
  • All about biomarker discovery

Our genomics solutions support you along your drug development chain of small and large molecules and in precision medicine.

>> Show all products

Plant Breeder

  • DNA marker discovery
  • Marker-assisted selection
  • GRAS-Di®
  • Microbiome and metagenomics

Animal Breeder

  • DNA Marker discovery
  • Pathogen screening
  • Parentage testing
  • Genomic selection
  • Marker-assisted selection

Favorite Content

  • Microarrays Accelerate Blue Biotechnology
  • How To Do NGS 50% Faster
  • NGS Portfolio

Benefit from our range of tailored, high throughput genotyping solutions to help you achieve your goals faster, for less.

>> Show all products

Sequencing Services

  • Genotyping
  • Epigenome Profiling
  • Microbiome Analysis
  • Shotgun Sequencing
  • Whole Genome Sequencing

Additional Services

  • Sample Collection Kits
  • Shipping
  • DNA Extraction
  • Laboratory Service
  • Biobanking

Favorite Content

  • Population Genetics
  • The End of Gene Doping
  • Home Genomics Testing
  • IVDR Compliance

Welcome to your full-service laboratory. Benefit from our end-to end solutions for sample collection kit logistics and genomic solutions.

>> Show all products

Food Testing

  • Food Authenticity
  • Meat Traceability
  • Pathogen Traceability
  • Cannabis and Hemp Testing

Environmental Testing

  • Non-targeted detection of organisms / species
  • Targeted detection of organisms / species
  • eDNA Tracker

Favorite Content

  • Determine the Source of Meat
  • Pine Nuts – Why Testing For Edibility Matters

DNA-based solutions to improve and support your analysis, monitoring and traceability across your value chain.

>> Show all products

Synthesis Products

  • Large Scale Oligos
  • Special Requests in Tubes
  • Special Requests in Plates

Quality Assurance

  • GLP
  • ISO 17025
  • ISO 13485

Favorite Content

  • Oligonucleotides For Diagnostics
  • The Future of RNA Applications

Our scalable and high-quality oligonucleotides synthesis offer makes us an ideal partner for your industry applications.

>> Show all products

Favorite Services

  • Custom DNA Oligos
  • TubeSeq Services Sanger
  • INVIEW Microbiome NGS
  • NGS Services
  • GeneStrands

Express Services

  • TubeSeq NightXpress
  • Mix2Seq NightXpress
  • Express Genes
  • Express GeneStrands

Favorite Content

  • Eurofins Genomics Goes Green
  • GENEius – Codon Usage Optimisation
  • 5 tips to speed up your qPCR

For your research project in academic, governmental and industrial environment we have the right genomic service.

>> Show all products

Corporate Information

  • About us
  • Career
  • Events
  • Press Releases
  • Collaborations
  • Blog
  • Newsletter
  • Quality Assurance
  • Lab closure times

Help

  • Video Tutorials
  • Ordering
  • Payment
  • Shipping & Delivery
  • Downloads
  • Data & Privacy
  • Material and Methods

Contact us

Eurofins Genomics
Germany GmbH
Anzinger Str. 7a
85560 Ebersberg
Germany

  • phone +49 7531 816068
  • e-mail support

Get in touch with us!

You need support or advice with your order? You don't find the perfect product or you like to get consultation regarding your results?

>> Get in touch

Find your product

Find your product

  • Sequencing Primer
  • PCR Primer
  • Mycoplasmacheck
  • SALE %
  • TubeSeq

Login to Eurofins

Please login with your email address and password!

>> Login

New at Eurofins Genomics?

Register a new account at Eurofins Genomics!

>> Register
Impersonating: Max Mustermann

Administration

  • Ecom Admin
  • Stop Impersonating

Welcome

Julian Schlossmacher

Login / Register

 
Email
Email can not be empty
Password:
Password can not be empty
Forgot password?
Create Account
No SSL
>> Logout >> My profile

Contact

Dr. Melvin Siliakus

+31 629 39 25 66 >> Send message

Account

  • Overview
  • Orders
  • Quotes
  • EVOcards
  • Preferences
  • DropBoxes
  • Sanger Kits & Barcodes
  • NGS Barcodes & Coupons
  • Sanger Samples & Primers
  • Oligo Coupons

Language

model-logo

New Website Navigation explained

>> Close
6

Last added items

0 Item(s)

Go to Cart

>> Go to cart X
 

Quick Order

X

Industrial-grade Products & Services

What are industrial-grade products? <<click here >>

Oligonucleotide Synthesis

  • Ultimate Precision Probes
  • NGSgrade Oligos in Tubes
  • NGSgrade Oligos in Plates
  • Request for Oligos in Tubes
  • Request for Oligos in Plates
  • Large Scale Oligos

Gene Synthesis & Molecular Biology

  • Gene Synthesis
  • GeneStrands
  • Express GeneStrands
  • Plasmid Preparation
  • Cloning Service

Next Generation Sequencing

  • Genome (Re-)Sequencing
  • Transcriptome Sequencing
  • Microbiome profiling
  • Exome Sequencing
  • Clinical Research Exome
  • Oncoprofiling
  • Liquid Biopsy Sample Sequencing
  • Ready-to-Load
  • Virus Sequencing
  • Amplicon Sequencing
  • Metagenome
  • ONT products
  • NGS Barcodes & UPS labels
  • Replacement samples
  • NGS Additional Services

Genotyping & Genexpression

  • Cell Line Authentication
  • Fragment Length Analysis
  • Mycoplasmacheck Barcodes
  • Cell Line Barcodes

Oligonucleotide Synthesis

Primers & Probes for qPCR Applications

  • PCR Primer in Tubes
  • PCR Primer NightXpress
  • PCR Primer in Plates
  • LocNA Primer
  • Dual Labeled Probes
  • MGB Probes
  • LocNA Probe
  • Molecular Beacons
  • LightCycler Probes
  • Probe based qPCR Assay
  • Ultimate Precision Probes

Oligos for Next Generation Sequencing

  • NGSgrade Oligos 2.0 Tubes
  • NGSgrade Oligos 2.0 Plate
  • NGSgrade Oligos in Tubes
  • NGS Oligos for NovaSeq
  • NGS Oligos for MiSeq
  • NGS UDI Primer Sets

Primers for Sanger Sequencing

  • SeqPrimer in Tubes
  • SeqPrimer NightXpress
  • SeqPrimer in Plates
  • Standard Primer

Oligos for Cloning Applications

  • Cloning Oligos
  • EXTREmer Oligos

Custom Oligos

  • Custom DNA Oligos in Tube
  • SaltFree Oligo NightXpress
  • Custom DNA Oligos in Plates
  • Custom RNA Oligos
  • O-Methyl-RNA / Chimerics
  • RNA qPCR Probes
  • siMAX siRNA
  • Special Oligos in Tubes

Oligo Tools

  • Oligo Analysis Tool
  • PCR Primer Design
  • SeqPrimer Design
  • qPCR Assay Design
  • siRNA Assay Design
  • Prepaid Oligo Coupons

Gene Synthesis & Molecular Biology

Synthetic genes

  • Gene Synthesis
  • Combinatorial libraries
  • Gene Synthesis Projects

GeneStrands

  • GeneStrands
  • Express GeneStrands

Molecular Biology Services

  • Plasmid Preparation
  • Site Directed Mutagenesis
  • DNA Cloning Service

Sanger Sequencing

Sanger Sequencing Services

  • TubeSeq Supreme
  • PlateSeq Supreme
  • Direct Colony Sequencing
  • Ready2Load Plate
  • Ready2Load Tube
  • Whole Plasmid Sequencing Tubes
  • Whole Plasmid Sequencing Plate
  • TubeSeq NightXpress
  • Primer Walking Service

Prepaid Products for Sanger Sequencing

  • Prepaid Barcodes & Coupons
  • Mix2Seq Kits
  • PlateSeq Kits
  • LightRun Barcodes
  • ONT Coupons

Additional Services

  • Tube & Plate Barcode Labels
  • Sequencing Accessories
  • Sample Shipment
  • Sequencing Primer Design

Next Generation Sequencing

Genome Sequencing

  • INVIEW Resequencing
  • NGSelect DNA
  • Whole Genome Sequencing
  • Bact. Whole Genome Seq (ONT)

Transcriptome Sequencing

  • INVIEW Transcriptome
  • NGSelect RNA

Metagenome / Microbiome

  • INVIEW Microbiome
  • INVIEW Metagenome

Exome Sequencing & Oncology Solutions

  • INVIEW Human Exome
  • Liquid Biopsy Samples
  • INVIEW Oncoprofiling
  • Clinical Research Exome

CRISPR & Prepaid NGS Coupons

  • INVIEW CRISPR Check
  • Redeem NGS Coupons
  • Order NGS Coupons

VIRUS

  • INVIEW Virus

Plasmid Sequencing

  • INVIEW Plasmid Verification
  • Whole Plasmid Sequencing (ONT) Tubes
  • Whole Plasmid Sequencing (ONT) Plate

Amplicon sequencing & Ready-to-Load

  • NGSelect Amplicon
  • NGSelect Ready-to-Load
  • Clonal Amplicons (ONT)

Oxford Nanopore projects (WGS, Amplicons, 16S)

  • ONT projects

ONT Lite

  • ONT Lite Whole Plasmid Sequencing
  • ONT Lite Clonal Amplicon Sequencing
  • ONT Lite Bacterial Genome Sequencing
  • ONT Lite Assembly Review

Additional Services

  • NGS Barcodes & UPS labels
  • NGS Additional Services
  • Sample Submission Guidelines
  • Prepaid NGS Coupons
  • Replacement samples
  • Request for Information

Genotyping & Gene Expression

Mycoplasmacheck

  • Mycoplasmacheck Barcodes
  • Mycoplasmacheck results

CLA & FLA

  • Cell line authentication Service (CLA)
  • Fragment length Analysis (FLA)
  • Cell line authentication barcodes

Others

  • Genotyping request form

EVOcard

Order / Refill EVOcard

Login / Register

 
Email
Email can not be empty
Password:
Password can not be empty
Forgot password?
Create Account
No SSL

 

  • Order Menu

    EVOcards

    • EVOcard bestellen / aufladen

    Oligonucleotides & siRNA

    • (q)PCR Primer in Tubes
    • (q)PCR Primer in Platte
    • (q)PCR Primer NightXpress
    • SeqPrimer in Tubes
    • SeqPrimer in Platte
    • SeqPrimer NightXpress
    • Custom DNA Oligos in Tubes
    • Custom DNA Oligos in Platte
    • SaltFree Oligo NightXpress
    • NGSgrade Oligos in Tubes
    • Standard Primer
    • Standard Primer NightXpress
    • LocNA Primer
    • LocNA Probes
    • Dual Labeled Probes
    • MGB Probes
    • Probe based qPCR Assay
    • Cloning Oligos in Tubes
    • EXTREmer Oligos
    • Nano-Scale Plate Oligos
    • NGS UDI Primer Sets
    • Custom RNA Oligos
    • RNA qPCR Probes
    • siMAX siRNA
    • Large Scale Oligos
    • Spezialanfragen
    • Mehr...

    Custom DNA Sequencing

    • Mix2Seq Kits
    • LightRun Barcodes
    • Sequenzier-Primer
    • TubeSeq Service
    • SupremeRun Tube
    • Tube & Platten Barcode Labels
    • TubeSeq Labels & Coupons
    • SupremeRun Barcodes
    • Sequenzier-Accessories
    • PlateSeq Kits
    • SupremeRun 96
    • Primer Walking
    • PlateSeq Service
    • SupremeRun | Multiprimer
    • Sequenzierprojekte
    • Direct Colony Sequencing
    • Ready2Load Plate
    • Mehr...

    Next Generation Sequencing

    • INVIEW Microbiom Profiling
    • NGSelect DNA
    • Barcode & UPS Labels
    • INVIEW Transcriptome
    • NGSelect RNA
    • Angebotsanfrage
    • INVIEW Exom
    • NGSelect Amplikon
    • Ersatzproben
    • INVIEW Resequencing
    • NGSelect Amplicon 2nd PCR
    • Probenvorbereitung
    • INVIEW CRISPR Check
    • Coupons einlösen
    • Mehr ...
    • INVIEW Oncopanel
    • SARS-CoV-2 RNA-Seq

    Gene Synthesis & Molecular Biology

    • Gen-Bestellseite
    • Plasmid Präparation
    • GeneStrands
    • Express Gene
    • DNA Klonierung
    • Genbibliotheken
    • Gensynthese Projekte
    • Ortsgerichtete Mutagenese
    • Express GeneStrands
    • Corona Kontrollplasmide

    Genotyping & Gene Expression

    • Zelllinienauthentifizierung
    • Mycoplasmacheck
    • Fragmentlängen-Analyse
    • Zelllinien-Barcodes
    • Angebotsanfrage

0 Item(s)

Go to Cart

  • DNA & RNA
    Oligonucleotides
    • >

      Optimised Application Oligos

    • >
      PCR Primers
    • >
      SeqPrimer
    • >
      Cloning Oligo
    • >
      EXTREmers
    • >
      NGSgrade Oligos
    • >

      qPCR Probes

    • >
      Custom DNA & RNA Oligos
    • >
      Custom DNA Oligos
    • >
      Large-Scale Oligos
    • >
      Custom RNA Oligos
    • >
      siMAX siRNA
    • >
      Spezialanfragen
  • Custom DNA
    Sequencing
    • >

      Eurofins Services

    • >
      Mix2Seq
    • >
      Mix2Seq Kits
    • >
      TubeSeq Services
    • >
      TubeSeq Labels & Coupons
    • >
      PlateSeq Service
    • >
      PlateSeq Kits
    • >
      Direct Colony Sequencing
    • >
      Whole Plasmid Sequencing
    • >

      LightRun Services

    • >
      LightRun Barcodes
    • >
      GATC Services
    • >

      Zusätzliche Services

    • >
      Tube & Platten Barcode Labels
    • >
      Sequenzier-Primer
    • >
      Sequenzier-Accessories
    • >
      Probenversand
    • >
      Kostenlose Probenabholung
  • Next Generation Sequencing
    • >

      NGS Built For You

    • >
      INVIEW Microbiome
    • >
      INVIEW Metagenome
    • >
      INVIEW Transcriptome
    • >
      INVIEW Exome
    • >
      INVIEW CRISPR Check
    • >
      INVIEW Virus
    • >
      NGS Prepaid Coupons
    • >
      INVIEW Plasmid Verification
    • >

      NGS Build Your Own

    • >
      NGSelect DNA
    • >
      NGSelect RNA
    • >
      NGSelect Amplikon
    • >
      NGSelect Ready2Load
    • >

      NGS Projekte

    • >
      Genom-Sequenzierung
    • >

      Anwendungen

    • >
      Onkologie Lösungen
  • Gensynthese & Molekularbiologie
    • >

      Gensynthese

    • >
      Standard Gene
    • >
      Express Gene
    • >
      Komplexe Gene
    • >
      Genbibliotheken
    • >
      GeneStrands
    • >
      Express GeneStrands
    • >
      Gene im neuen Shop
    • >

      GENEius

    • >
      Sequenzoptimierung
    • >
      Codon Usage Anpassung
    • >
      GENEius Und Ecom
    • >

      Molekularbiologische Services

    • >
      Plasmid Präparation
    • >
      Ortsgerichtete Mutagenese
    • >

      Anwendungen

    • >
      CRISPR/Cas9
  • Genotypisierung & Genexpression
    • >

      Service Plattformen

    • >
      Illumina Array Plattformen
    • >
      Affymetrix Array Plattformen
    • >
      Fluidigm BioMark & EP1
    • >
      Roche LightCycler
    • >
      Sanger Sequenzierung & NGS
    • >

      Genotypisierung Services

    • >
      SNP Genotypisierung
    • >
      Mikrosatelliten / STR / FLA / IDAA
    • >
      Mittels Sequenzierung
    • >
      Genotypisierung mittels PCR
    • >
      Genom-weite Assoziationen
    • >
      Humanidentifizierung
    • >
      Copy Number Variation
    • >

      Genexpression Services

    • >
      Transkriptomanalyse
    • >
      Expressionsarrays
    • >
      Target Gene Expression
    • >
      miRNA / small RNA Analyse
    • >

      Applied Genomics Services

    • >
      Residual DNA Nachweis
    • >
      DNA Barcoding
    • >
      Zelllinienauthentifizierung
    • >
      Mycoplasmacheck
 

Super Express Genes Group B

  Intro & Info

This is the order page for Super Express Genes.
 
  • Entry Format
  • Additional Options
  • Sequence Validation
  • Summary & Review
 

Entry Formats

Number of genes:
 
Please select the number of genes you want to order and press "Next".
You can always add more or leave lines empty on the next page.
 
 
Gene sequences can be DNA or Amino Acid. Name and sequence can be separated by a blank, tab, comma or semicolon:

Gene1[blank]TACGACGGAGTGTTATAAGATGGGAAATCGGATACCAGATGAAATTG
Gene2[TAB]TACGACGGAGTGTTATAAGATGGGAAATCGGATACCAGATGAAATTGTG
Gene3,FTGSNVEDRSSSGSWGNGGHPSPSRNYGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKSQY
Gene4;SWGNGGHPSPSRNYGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTSYSSYGRESN

XLS Icon Download our Excel template for uploading your genes.
Allowed file formats are xls, xlsx and csv. The file needs two columns named name and sequence without a special format.
 
 
 
Define your genes by using our Excel template above. Upload your file and press "Next".
 
 
Next
 
Production Site
  • Europe
  • America
  • India
  • Japan
Eurofins Genomics
  • Terms & Conditions
  • Sitemap
  • Imprint
  • Privacy
  • Licenses
  • Cookie Settings
Contact
General Customer Support
phone +49 7531 816068
Toll free phone number for
Europe: 00800 200 100 20
support-eu@genomics.eurofinseu.com

Eurofins Genomics Europe Shared Services GmbH
Anzinger Str. 7a
85560 Ebersberg
Germany

/p>

2025 - Eurofins Genomics

VEGA Beta