Gene Synthesis                                            
progress bar
progress bar

eurofins eurofins

Email
Password
 
  
Forgot Password?
Create Account
 
 
  • Quick Order
  • 0

    Cart

  • Account
    • Login
    • Create Account
  • Products & Services
    • DNA / RNA Oligos
      • Products & Services
      • DNA / RNA Oligos
        • qPCR application oligos
        • PCR Primers
        • qPCR Probes
        • Ultimate Precision Probes
        • Next Generation Sequencing Oligos
        • NGSgrade Oligos
        • NGSgrade Oligos 2.0
        • NGS UDI Primer Sets
        • Sanger Sequencing Oligos
        • SeqPrimer
        • Standard Primers
        • Cloning applications & CRISPR
        • Cloning Oligo
        • EXTREmers
        • Custom DNA & RNA Oligos
        • Custom DNA Oligos
        • Salt Free Oligos
        • Custom RNA Oligos
        • siMAX siRNA
        • Large Scale Oligos
        • Special Requests
        • Oligo Design Tools
        • Oligo Analysis Tool
        • PCR Primer Design Tool
        • qPCR Assay Design Tool
        • Sequencing Primer Design Tool
        • Helpful Links
        • Oligo Decision Tree
        • Oligo Excel Upload Forms

        • Prepaid Oligo Coupons
          A Unique Prepayment Option for PCR - and Sequencing Primers
          Learn more

           

           

    • Gene Synthesis & Molecular Biology
      • Products & Services
      • Gene Synthesis & Molecular Biology
        • Synthetic genes
        • Standard Genes
        • Express Genes
        • Complex Genes
        • Gene synthesis project
        • Gene Fragments
        • GeneStrands
        • Express GeneStrands
        • Molecular Biology Services
        • Plasmid Preparation
        • Site Directed Mutagenesis
        • DNA Cloning
        • IVT mRNA
        • Optimisation tool
        • GENEius
    • Sanger Sequencing
      • Products & Services
      • Sanger Sequencing
        • Sequencing Services
        • Mix2Seq Services
        • LightRun Services
        • TubeSeq Supreme
        • PlateSeq Supreme
        • Direct Colony Sequencing
        • Prepaid Products
        • Mix2Seq Kits
        • LightRun Barcodes
        • Barcode Labels & Coupons
        • PlateSeq Kits
        • Shipping Options
        • Sequencing Accessories
        • Sample Shipment
        • Additional Services
        • Sequencing Primers
        • Free Barcode Labels
        • Special Sequencing Services
        • Sequence Verification and Primer Walking under ISO 17025 & GLP
        • �
          Mix2Seq Kit
          Fastest Sanger sequencing of premixed samples in tubes.

          Order Now

           

           

    • Nanopore Sequencing
      • Products & Services
      • Nanopore Sequencing
        • ONT Lite Portfolio - Products
        • Whole Plasmid Sequencing
        • Linear / Clonal Amplicons
        • Bacterial Genome Sequencing
        • Bacteria Assembly Hybrid
        • Yeast Genome Sequencing
        • ONT Lite - Additional Services
        • Prepaid ONT Coupons
        • Free barcodes
        • ONT Lite Assembly Review
        • Genome Sequencing (Full Flow Cells)
        • Human Whole Genome Sequencing
        • Bacteria Whole Genome Sequencing
        • Whole Genome Sequencing Non-Human
        • Amplicon Sequencing (Full Flow Cells)
        • Custom Long-Read Amplicon Sequencing
        • 16S Full-Length Microbiome
        • Prepaid ONT Lite Coupons
          A Unique Prepayment Option for your sequencing with Oxford Nanopore

          Learn more

           

           

    • Next Generation Sequencing
      • Products & Services
      • Next Generation Sequencing
        • Genome Sequencing
        • Human WGS
        • Non-human WGS
        • INVIEW Resequencing
        • Mammal WGS
        • Microbiome & Metagenome
        • INVIEW Microbiome
        • INVIEW Metagenome
        • Amplicon Sequencing
        • Amplicon sequencing
        • Amplicon sequencing - incl. amplification
        • Transcriptome
        • INVIEW Transcriptome
        • INVIEW Transcriptome Bacteria
        • NGSelect RNA
        • Single Cell RNA Sequencing
        • Exome & Enrichment
        • INVIEW Exome
        • Clinical Research Exome
        • INVIEW Oncoprofiling
        • INVIEW Liquid Biopsy Oncoprofiling
        • Bioinformatic Services
        • RNA-Seq Analysis
        • Variant Analysis Service
        • Metagenome Analysis Service
        • Microbiome Profiling Analysis
        • Prepaid Coupons and free Barcodes
        • Free Barcodes
        • NGS Prepaid Coupons
        • Important information
        • Sample Submission Guidelines
        • NGS Publications
        • Request for Information
        • Special applications
        • INVIEW Virus
        • Ready-to-Load
        • Prepaid NGS Coupons

           

          A Unique Prepayment Option for our NGS Services

          Learn more

           

           

    • Genotyping & Genexpression
      • Products & Services
      • Genotyping & Genexpression
        • Applied Genomic Services
        • DNA Barcoding
        • Cell Line Authentication
        • Mycoplasmacheck
        • Fragment Length Analysis
        • Genotyping Services
        • SNP Genotyping
        • Copy Number Variation
        • Mikrosatellites/ STR/FLA/ IDAA
        • Gene Expression Services
        • Transcriptome analysis
        • Expression Arrays
        • Target Gene Expression
        • Species determination
        • Meat determination
        • Plant determination
        • Fish determination
        • Direct order pages for species determination
          Accurately identify meat / plant / fish species and verify authenticity

          Meat testing

          Plant testing

          Fish testing

  • Markets
    • All Markets
    • Pharma / Biotech
      • Markets
      • Pharma / Biotech
        • Overview
        • Pharma Portfolio
        • Oncology Portfolio
        • Synthesis Products
        • Industrial-grade NGS Oligos
        • Ultimate Precision Probes
        • Special Oligo Requests
        • Large Scale Oligos
        • Gene Synthesis
        • Gene Fragments
        • Sequencing Services
        • Exome Sequencing
        • Transcriptome Sequencing
        • Genome Sequencing
        • Bioinformatic Solutions for NGS
        • Favorite Content
        • NGS - Disease Diagnostics
        • Cancer Ecology
        • Personalised Cancer Therapy
        • Revolutionising human-like-protein production
        • The Microbiome Of Cancer
        • All about biomarker discovery
    • Agrigenomics
      • Markets
      • Agrigenomics
        • Overview
        • Agrigenomics Portfolio
        • Plant Breeder
        • DNA marker discovery
        • Marker-assisted selection
        • GRAS-Di®
        • Microbiome and metagenomics
        • Animal Breeder
        • DNA Marker discovery
        • Pathogen screening
        • Parentage testing
        • Genomic selection
        • Marker-assisted selection
        • Favorite Content
        • Microarrays Accelerate Blue Biotechnology
        • How To Do NGS 50% Faster
        • NGS Portfolio
    • Consumer Genomics
      • Markets
      • Consumer Genomics
        • Overview
        • Consumer Genomics Portfolio
        • Sequencing Services
        • Genotyping
        • Epigenome Profiling
        • Microbiome Analysis
        • Shotgun Sequencing
        • Whole Genome Sequencing
        • Additional Services
        • Sample Collection Kits
        • Shipping
        • DNA Extraction
        • Laboratory Service
        • Biobanking
        • Favorite Content
        • Population Genetics
        • The End of Gene Doping
        • Home Genomics Testing
        • IVDR Compliance
    • Food & Environment
      • Markets
      • Food & Environment
        • Overview
        • Food & Environment Portfolio
        • Food Testing
        • Food Authenticity
        • Meat Traceability
        • Pathogen Traceability
        • Environmental Testing
        • Non-targeted detection of organisms / species
        • Targeted detection of organisms / species
        • eDNA
        • Favorite Content
        • Determine the Source of Meat
        • Pine Nuts – Why Testing For Edibility Matters
        • Order pages for species determination
        • Meat species determination
        • Plant species determination
        • Fish species determination
        •  

          Fish determination & authenticity testing
          High-resolution genetic analysis for seafood products

          Learn more

           

        •  

          Meat determination & authenticity testing
          Accurately identify animal species and verify meat authenticity

          Learn more

           

           

           

        •  

          Plant differentiation & authenticity testing
          High-resolution genetic analysis for plant-based products

          Learn more

           

    • Diagnostic Kit Producer
      • Markets
      • Diagnostic Kit Producer
        • Overview
        • Kit Producer Portfolio
        • Synthesis Products
        • Large Scale Oligos
        • Special Requests in Tubes
        • Quality Assurance
        • GLP
        • ISO 17025
        • ISO 13485
        • Favorite Content
        • Oligonucleotides For Diagnostics
        • The Future of RNA Applications
    • Research / Biotech
      • Markets
      • Research / Biotech
        • Overview
        • Research Portfolio
        • Favorite Services
        • Custom DNA Oligos
        • TubeSeq Service Sanger
        • INVIEW Microbiome NGS
        • NGS Services
        • GeneStrands
        • Express Services
        • Mix2Seq NightXpress
        • Express Genes
        • Express GeneStrands
        • Favorite Content
        • Eurofins Genomics Goes Green
        • GENEius – Codon Usage Optimisation
        • 5 tips to speed up your qPCR
        • Why salt-free oligos are the unsung hero of molecular biology
  • Resources
    • Account
      • Resources
      • Account
        • My profile
        • Orders
        • Quotes
        • Groups
        • Preferences
        • Addresses
        • Dropboxes Nearby
        • Barcode Management
        • Sanger Barcode Management
        • NGS Barcode Management
        • Genotyping Barcode Management
        • Oligo Barcode Management
        • Primer / Cell Line Management
        • Sanger Sequencing Primers
        • Cell Line Management
    • Solutions
      • Resources
      • Solutions
        • EVOCARD Options
        • EVOcard Payment Method
        • Order or Refill EVOcards
        •  

    • Other Resources
      • Resources
      • Other Resources
        • Frequently Asked Questions (FAQs)
        • Video Tutorials
        • GENEius
        • Excel Upload Forms Oligos
        • GATCViewer
    • Tools
      • Resources
      • Tools
        • Design tools
        • PCR Primer Design Tool
        • Sequencing Primer Design Tool
        • Oligo Analysis Tool
  • About us
    • About Us
      • About us
      • About Us
        • About Eurofins
        • Careers
        • Distributors
        • News
        • Events
        • Holiday Hours
        • Imprint
    • Quality Control
      • About us
      • Quality Control
        • Quality Assurance
    • Promotions
      • About us
      • Promotions
        • View all promotions
        • Test our Services for Free
        • Gene Synthesis Deal
  • Contact
Logo
  • Products & Services
    • DNA / RNA Oligos
      • Products & Services
      • DNA / RNA Oligos
        • qPCR application oligos
        • PCR Primers
        • qPCR Probes
        • Ultimate Precision Probes
        • Next Generation Sequencing Oligos
        • NGSgrade Oligos
        • NGSgrade Oligos 2.0
        • NGS UDI Primer Sets
        • Sanger Sequencing Oligos
        • SeqPrimer
        • Standard Primers
        • Cloning applications & CRISPR
        • Cloning Oligo
        • EXTREmers
        • Custom DNA & RNA Oligos
        • Custom DNA Oligos
        • Salt Free Oligos
        • Custom RNA Oligos
        • siMAX siRNA
        • Large Scale Oligos
        • Special Requests
        • Oligo Design Tools
        • Oligo Analysis Tool
        • PCR Primer Design Tool
        • qPCR Assay Design Tool
        • Sequencing Primer Design Tool
        • Helpful Links
        • Oligo Decision Tree
        • Oligo Excel Upload Forms

        • Prepaid Oligo Coupons
          A Unique Prepayment Option for PCR - and Sequencing Primers
          Learn more

           

           

    • Gene Synthesis & Molecular Biology
      • Products & Services
      • Gene Synthesis & Molecular Biology
        • Synthetic genes
        • Standard Genes
        • Express Genes
        • Complex Genes
        • Gene synthesis project
        • Gene Fragments
        • GeneStrands
        • Express GeneStrands
        • Molecular Biology Services
        • Plasmid Preparation
        • Site Directed Mutagenesis
        • DNA Cloning
        • IVT mRNA
        • Optimisation tool
        • GENEius
    • Sanger Sequencing
      • Products & Services
      • Sanger Sequencing
        • Sequencing Services
        • Mix2Seq Services
        • LightRun Services
        • TubeSeq Supreme
        • PlateSeq Supreme
        • Direct Colony Sequencing
        • Prepaid Products
        • Mix2Seq Kits
        • LightRun Barcodes
        • Barcode Labels & Coupons
        • PlateSeq Kits
        • Shipping Options
        • Sequencing Accessories
        • Sample Shipment
        • Additional Services
        • Sequencing Primers
        • Free Barcode Labels
        • Special Sequencing Services
        • Sequence Verification and Primer Walking under ISO 17025 & GLP
        • �
          Mix2Seq Kit
          Fastest Sanger sequencing of premixed samples in tubes.

          Order Now

           

           

    • Nanopore Sequencing
      • Products & Services
      • Nanopore Sequencing
        • ONT Lite Portfolio - Products
        • Whole Plasmid Sequencing
        • Linear / Clonal Amplicons
        • Bacterial Genome Sequencing
        • Bacteria Assembly Hybrid
        • Yeast Genome Sequencing
        • ONT Lite - Additional Services
        • Prepaid ONT Coupons
        • Free barcodes
        • ONT Lite Assembly Review
        • Genome Sequencing (Full Flow Cells)
        • Human Whole Genome Sequencing
        • Bacteria Whole Genome Sequencing
        • Whole Genome Sequencing Non-Human
        • Amplicon Sequencing (Full Flow Cells)
        • Custom Long-Read Amplicon Sequencing
        • 16S Full-Length Microbiome
        • Prepaid ONT Lite Coupons
          A Unique Prepayment Option for your sequencing with Oxford Nanopore

          Learn more

           

           

    • Next Generation Sequencing
      • Products & Services
      • Next Generation Sequencing
        • Genome Sequencing
        • Human WGS
        • Non-human WGS
        • INVIEW Resequencing
        • Mammal WGS
        • Microbiome & Metagenome
        • INVIEW Microbiome
        • INVIEW Metagenome
        • Amplicon Sequencing
        • Amplicon sequencing
        • Amplicon sequencing - incl. amplification
        • Transcriptome
        • INVIEW Transcriptome
        • INVIEW Transcriptome Bacteria
        • NGSelect RNA
        • Single Cell RNA Sequencing
        • Exome & Enrichment
        • INVIEW Exome
        • Clinical Research Exome
        • INVIEW Oncoprofiling
        • INVIEW Liquid Biopsy Oncoprofiling
        • Bioinformatic Services
        • RNA-Seq Analysis
        • Variant Analysis Service
        • Metagenome Analysis Service
        • Microbiome Profiling Analysis
        • Prepaid Coupons and free Barcodes
        • Free Barcodes
        • NGS Prepaid Coupons
        • Important information
        • Sample Submission Guidelines
        • NGS Publications
        • Request for Information
        • Special applications
        • INVIEW Virus
        • Ready-to-Load
        • Prepaid NGS Coupons

           

          A Unique Prepayment Option for our NGS Services

          Learn more

           

           

    • Genotyping & Genexpression
      • Products & Services
      • Genotyping & Genexpression
        • Applied Genomic Services
        • DNA Barcoding
        • Cell Line Authentication
        • Mycoplasmacheck
        • Fragment Length Analysis
        • Genotyping Services
        • SNP Genotyping
        • Copy Number Variation
        • Mikrosatellites/ STR/FLA/ IDAA
        • Gene Expression Services
        • Transcriptome analysis
        • Expression Arrays
        • Target Gene Expression
        • Species determination
        • Meat determination
        • Plant determination
        • Fish determination
        • Direct order pages for species determination
          Accurately identify meat / plant / fish species and verify authenticity

          Meat testing

          Plant testing

          Fish testing

  • Markets
    • All Markets
    • Pharma / Biotech
      • Markets
      • Pharma / Biotech
        • Overview
        • Pharma Portfolio
        • Oncology Portfolio
        • Synthesis Products
        • Industrial-grade NGS Oligos
        • Ultimate Precision Probes
        • Special Oligo Requests
        • Large Scale Oligos
        • Gene Synthesis
        • Gene Fragments
        • Sequencing Services
        • Exome Sequencing
        • Transcriptome Sequencing
        • Genome Sequencing
        • Bioinformatic Solutions for NGS
        • Favorite Content
        • NGS - Disease Diagnostics
        • Cancer Ecology
        • Personalised Cancer Therapy
        • Revolutionising human-like-protein production
        • The Microbiome Of Cancer
        • All about biomarker discovery
    • Agrigenomics
      • Markets
      • Agrigenomics
        • Overview
        • Agrigenomics Portfolio
        • Plant Breeder
        • DNA marker discovery
        • Marker-assisted selection
        • GRAS-Di®
        • Microbiome and metagenomics
        • Animal Breeder
        • DNA Marker discovery
        • Pathogen screening
        • Parentage testing
        • Genomic selection
        • Marker-assisted selection
        • Favorite Content
        • Microarrays Accelerate Blue Biotechnology
        • How To Do NGS 50% Faster
        • NGS Portfolio
    • Consumer Genomics
      • Markets
      • Consumer Genomics
        • Overview
        • Consumer Genomics Portfolio
        • Sequencing Services
        • Genotyping
        • Epigenome Profiling
        • Microbiome Analysis
        • Shotgun Sequencing
        • Whole Genome Sequencing
        • Additional Services
        • Sample Collection Kits
        • Shipping
        • DNA Extraction
        • Laboratory Service
        • Biobanking
        • Favorite Content
        • Population Genetics
        • The End of Gene Doping
        • Home Genomics Testing
        • IVDR Compliance
    • Food & Environment
      • Markets
      • Food & Environment
        • Overview
        • Food & Environment Portfolio
        • Food Testing
        • Food Authenticity
        • Meat Traceability
        • Pathogen Traceability
        • Environmental Testing
        • Non-targeted detection of organisms / species
        • Targeted detection of organisms / species
        • eDNA
        • Favorite Content
        • Determine the Source of Meat
        • Pine Nuts – Why Testing For Edibility Matters
        • Order pages for species determination
        • Meat species determination
        • Plant species determination
        • Fish species determination
        •  

          Fish determination & authenticity testing
          High-resolution genetic analysis for seafood products

          Learn more

           

        •  

          Meat determination & authenticity testing
          Accurately identify animal species and verify meat authenticity

          Learn more

           

           

           

        •  

          Plant differentiation & authenticity testing
          High-resolution genetic analysis for plant-based products

          Learn more

           

    • Diagnostic Kit Producer
      • Markets
      • Diagnostic Kit Producer
        • Overview
        • Kit Producer Portfolio
        • Synthesis Products
        • Large Scale Oligos
        • Special Requests in Tubes
        • Quality Assurance
        • GLP
        • ISO 17025
        • ISO 13485
        • Favorite Content
        • Oligonucleotides For Diagnostics
        • The Future of RNA Applications
    • Research / Biotech
      • Markets
      • Research / Biotech
        • Overview
        • Research Portfolio
        • Favorite Services
        • Custom DNA Oligos
        • TubeSeq Service Sanger
        • INVIEW Microbiome NGS
        • NGS Services
        • GeneStrands
        • Express Services
        • Mix2Seq NightXpress
        • Express Genes
        • Express GeneStrands
        • Favorite Content
        • Eurofins Genomics Goes Green
        • GENEius – Codon Usage Optimisation
        • 5 tips to speed up your qPCR
        • Why salt-free oligos are the unsung hero of molecular biology
  • Resources
    • Account
      • Resources
      • Account
        • My profile
        • Orders
        • Quotes
        • Groups
        • Preferences
        • Addresses
        • Dropboxes Nearby
        • Barcode Management
        • Sanger Barcode Management
        • NGS Barcode Management
        • Genotyping Barcode Management
        • Oligo Barcode Management
        • Primer / Cell Line Management
        • Sanger Sequencing Primers
        • Cell Line Management
    • Solutions
      • Resources
      • Solutions
        • EVOCARD Options
        • EVOcard Payment Method
        • Order or Refill EVOcards
        •  

    • Other Resources
      • Resources
      • Other Resources
        • Frequently Asked Questions (FAQs)
        • Video Tutorials
        • GENEius
        • Excel Upload Forms Oligos
        • GATCViewer
    • Tools
      • Resources
      • Tools
        • Design tools
        • PCR Primer Design Tool
        • Sequencing Primer Design Tool
        • Oligo Analysis Tool
  • About us
    • About Us
      • About us
      • About Us
        • About Eurofins
        • Careers
        • Distributors
        • News
        • Events
        • Holiday Hours
        • Imprint
    • Quality Control
      • About us
      • Quality Control
        • Quality Assurance
    • Promotions
      • About us
      • Promotions
        • View all promotions
        • Test our Services for Free
        • Gene Synthesis Deal
  • Contact
Login | Create Account
Header Image
 

Gene Synthesis

  Intro & Info

Welcome to our Gene Synthesis order platform.

How to enter your gene details:
  • Select the entry format of your gene name and gene sequence:
    • Single input: Select the number of genes and enter the information later directly on the page
    • Copy&Paste: if you have a copy ready format of all your genes you can easily paste them in here
    • File-Upload: use our Excel template to upload your sequences and names.
  • Additional Options:
    • Here you need to define all properties for your genes: optimisation required, restriction sites, subcloning vectors and plasmid preparation scale
  • Sequence validation:
    • For customers using "Single input" you now need to add your gene sequence
    • For all other entry formats the gene sequences are displayed here.
    • All sequences will now be checked for complexities and in case of codon optimisation it will directly be optimised
  • Summary & Review:
    • If your genes apply for "Express Genes" you can select here the express production times. In addition you can download a summary of your gene order.

The gene synthesis wizard is able to manage all kind of genes: Standard, Complex and Express Genes.

Using Templates:
  • If you order genes on a regular basis you can save your "additional options" as template and simply select the correct template.
  • You can add several templates to ensure that you have one template for each gene category you need.

Email notification for gene optimisation:
If you are logged in while entering your gene order you don't need to wait for GENEius to optimise your sequence. Our system will do that for you in the background and inform you via Email when the optimisation is successfully performed. The order will automatically be placed in your cart.

Risk group classification sheet

For gene synthesis orders including subcloning please download the risk group classification sheet and send the filled form to genes-eu[at]genomics.eurofinseu.com after placing your order.
 
  • Entry Format
  • Additional Options
  • Sequence Validation
  • Summary & Review
 

Entry Formats

Number of genes:
 
Please select the number of genes you want to order and press "Next".
You can always add more or leave lines empty on the next page.
 
 
Gene sequences can be DNA or Amino Acid. Name and sequence can be separated by a blank, tab, comma or semicolon:

Gene1[blank]TACGACGGAGTGTTATAAGATGGGAAATCGGATACCAGATGAAATTG
Gene2[TAB]TACGACGGAGTGTTATAAGATGGGAAATCGGATACCAGATGAAATTGTG
Gene3,FTGSNVEDRSSSGSWGNGGHPSPSRNYGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKSQY
Gene4;SWGNGGHPSPSRNYGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTSYSSYGRESN

XLS Icon Download our Excel template for uploading your genes.
Allowed file formats are xls, xlsx and csv. The file needs two columns named name and sequence without a special format.
 
 
 
Define your genes by using our Excel template above. Upload your file and press "Next".
 
 
Next
 
Contact Us

TECHNICAL SUPPORT

Phone: +49 (8092) 3379800

Toll Free Phone Number: 00800-200 100 20

E-Mail: support-eu@genomics.eurofinseu.com

HOURS

Mon-Thu: 8 : 00 AM – 5 : 00 PM, ET

Friday: 8 : 00 AM – 4 : 00 PM, ET

QUOTES, PRICING & SPECIAL REQUESTS

Quotes are submitted, reviewed, and accepted through the online quoting tool. Learn more.
Please direct inquires about pricing and special project requests to your sales representative.
General questions: support-eu@genomics.eurofinseu.com

Change Region

  • Europe (current website)
  • America
  • India
  • Japan

We love hearing from our customers. Feel free to leave feedback.

Submit Feedback
Careers
  • ISO 9001
  • ISO 13485
  • ISO 17025

2026 - Copyright Eurofins Genomics

  • Terms & Conditions
  • Corporate
  • Privacy
  • Imprint
VEGA Beta