Industrial-grade gene synthesis
progress bar
progress bar

Frequently asked questions
Contact us
Subscribe to newsletter
w10.0.14 | c1.25.03.1
PROD | u7.5.14
  Quick Order  0
Ecom-Admin
  • Markets
  • Products
  • Company
  • Contact
  • EN
  • Oligonucleotide Synthesis
  • Gene Synthesis & Molecular Biology
  • Sanger Sequencing
  • Next Generation Sequencing
  • Genotyping & Gene Expression

Further Information:

>> EVOcard

>> Product FAQs

>> SALE %

Application Oligos

  • qPCR Probes
  • Ultimate Precision Probes
  • PCR Primer
  • SeqPrimer
  • Cloning Oligos
  • NGSgrade Oligos 2.0
  • NGSgrade Oligos
  • NGS UDI Primer Sets
>> Show more

Custom Oligos

  • Custom DNA Oligos
  • Salt-Free Oligos
  • Large Scale Oligos
  • Custom RNA Oligos
  • Special Requests
>> Show more

Oligo Tools

  • Oligo Analysis Tool
  • PCR Primer Design Tool
  • Sequencing Primer Design Tool
  • qPCR Assay Design Tool
  • siRNA Design Tool
  • Prepaid Oligo Coupons
  • Excel Order Forms
>> Show more

Benefit from more than 25 years of experience in oligonucleotide synthesis!

>> Show all products

Gene Synthesis

  • Standard Genes
  • Express Gene
  • Gene Synthesis Project
  • GENEius
>> Show more

GeneStrands

  • GeneStrands
  • Express GeneStrands

Molecular Biology Services

  • Plasmid Preparation
  • CRISPR/Cas9
>> Show more

Optimise your research and save time with high quality gene synthesis and molecular biology services.

>> Show all products

Sequencing Services

  • Mix2Seq Service
  • LightRun Services
  • TubeSeq Supreme
  • PlateSeq Supreme
  • Direct Colony Sequencing
  • Whole Plasmid Sequencing
  • Primer Walking Service
>> Show more

Prepaid Products

  • Mix2Seq Kits
  • LightRun Barcodes
  • Barcode Labels & Coupons
  • PlateSeq Kits
  • PlateSeq Kit Colony
  • ONT Prepaid Coupons
>> Show more

Additional Services

  • Free Barcode Labels
  • Sequencing Accessories
  • Sequencing Primers
  • Sample Shipment
>> Show more

Hiqh quality Sanger sequencing with highest flexibility for every sample type.

>> Show all products

Top 5 Products

  • INVIEW Resequencing
  • INVIEW Microbiome
  • INVIEW Transcriptome
  • INVIEW Metagenome
  • Amplicon sequencing
  • Bioinformatic services
  • Genome sequencing
>> Show more

Spotlight

  • INVIEW Exome
  • INVIEW Virus
  • INVIEW CRISPR Check
  • NGS Prepaid Coupons
  • Oncology Solutions
  • OLINK Explore 3072
  • Clinical Research Exome
  • Bacteria Hybrid Assembly
>> Show more

Oxford Nanopore Products

  • Whole Plasmid Sequencing
  • Linear / Clonal Amplicons
  • Bacterial Genome Sequencing
  • 16S Full-Length Microbiome
  • Complete ONT Portfolio
>> Show more

NGS from experts - ISO-certified, fully automated and easy to order online.

>> Show all products

Applied Genomic Services

  • DNA Barcoding
  • Cell Line Authentication
  • Mycoplasmacheck
  • Fragment Length Analysis
>> Show more

Genotyping services

  • SNP Genotyping
  • Copy Number Variation
  • Mikrosatellites/ STR/FLA/ IDAA
>> Show more

Gene Expression Services

  • Transcriptome analysis
  • Expression Arrays
  • Target Gene Expression
>> Show more

Cell line authentication, Mycoplasmacheck, Fragment length analysis & tailored projects.

>> Show all products
  • Pharma / Biotech
  • Agrigenomics
  • Consumer Genomics
  • Food & Environment
  • Diagnostic Kit Producer
  • Research / Biotech

Further Information:

>> Quality

>> Events

Synthesis Products

  • Industrial-grade NGS Oligos
  • Ultimate Precision Probes
  • Special Oligo Requests
  • Large Scale Oligos
  • Gene Synthesis
  • GeneStrands
  • Plasmid Preparation

Sequencing Services

  • Amplicon Sequencing
  • Exome Sequencing
  • Transcriptome Sequencing
  • Primer Walking Service

Favorite Content

  • NGS – Disease Diagnostics
  • Cancer Ecology
  • Personalised Cancer Therapy
  • Revolutionising human-like-protein production
  • The Microbiome Of Cancer
  • All about biomarker discovery

Our genomics solutions support you along your drug development chain of small and large molecules and in precision medicine.

>> Show all products

Plant Breeder

  • DNA marker discovery
  • Marker-assisted selection
  • GRAS-Di®
  • Microbiome and metagenomics

Animal Breeder

  • DNA Marker discovery
  • Pathogen screening
  • Parentage testing
  • Genomic selection
  • Marker-assisted selection

Favorite Content

  • Microarrays Accelerate Blue Biotechnology
  • How To Do NGS 50% Faster
  • NGS Portfolio

Benefit from our range of tailored, high throughput genotyping solutions to help you achieve your goals faster, for less.

>> Show all products

Sequencing Services

  • Genotyping
  • Epigenome Profiling
  • Microbiome Analysis
  • Shotgun Sequencing
  • Whole Genome Sequencing

Additional Services

  • Sample Collection Kits
  • Shipping
  • DNA Extraction
  • Laboratory Service
  • Biobanking

Favorite Content

  • Population Genetics
  • The End of Gene Doping
  • Home Genomics Testing
  • IVDR Compliance

Welcome to your full-service laboratory. Benefit from our end-to end solutions for sample collection kit logistics and genomic solutions.

>> Show all products

Food Testing

  • Food Authenticity
  • Meat Traceability
  • Pathogen Traceability
  • Cannabis and Hemp Testing

Environmental Testing

  • Non-targeted detection of organisms / species
  • Targeted detection of organisms / species
  • eDNA Tracker

Favorite Content

  • Determine the Source of Meat
  • Pine Nuts – Why Testing For Edibility Matters

DNA-based solutions to improve and support your analysis, monitoring and traceability across your value chain.

>> Show all products

Synthesis Products

  • Large Scale Oligos
  • Special Requests in Tubes
  • Special Requests in Plates

Quality Assurance

  • GLP
  • ISO 17025
  • ISO 13485

Favorite Content

  • Oligonucleotides For Diagnostics
  • The Future of RNA Applications

Our scalable and high-quality oligonucleotides synthesis offer makes us an ideal partner for your industry applications.

>> Show all products

Favorite Services

  • Custom DNA Oligos
  • TubeSeq Services Sanger
  • INVIEW Microbiome NGS
  • NGS Services
  • GeneStrands

Express Services

  • TubeSeq NightXpress
  • Mix2Seq NightXpress
  • Express Genes
  • Express GeneStrands

Favorite Content

  • Eurofins Genomics Goes Green
  • GENEius – Codon Usage Optimisation
  • 5 tips to speed up your qPCR

For your research project in academic, governmental and industrial environment we have the right genomic service.

>> Show all products

Corporate Information

  • About us
  • Career
  • Events
  • Press Releases
  • Collaborations
  • Blog
  • Newsletter
  • Quality Assurance
  • Lab closure times

Help

  • Video Tutorials
  • Ordering
  • Payment
  • Shipping & Delivery
  • Downloads
  • Data & Privacy
  • Material and Methods

Contact us

Eurofins Genomics
Germany GmbH
Anzinger Str. 7a
85560 Ebersberg
Germany

  • phone +49 7531 816068
  • e-mail support

Get in touch with us!

You need support or advice with your order? You don't find the perfect product or you like to get consultation regarding your results?

>> Get in touch

Find your product

Find your product

  • Sequencing Primer
  • PCR Primer
  • Mycoplasmacheck
  • SALE %
  • TubeSeq

Login to Eurofins

Please login with your email address and password!

>> Login

New at Eurofins Genomics?

Register a new account at Eurofins Genomics!

>> Register
Impersonating: Max Mustermann

Administration

  • Ecom Admin
  • Stop Impersonating

Welcome

Julian Schlossmacher

Login / Register

 
Email
Password:
Forgot password?
Create Account
No SSL
>> Logout >> My profile

Contact

Dr. Melvin Siliakus

+31 629 39 25 66 >> Send message

Account

  • Overview
  • Orders
  • Quotes
  • EVOcards
  • Preferences
  • DropBoxes
  • Sanger Kits & Barcodes
  • NGS Barcodes & Coupons
  • Sanger Samples & Primers
  • Oligo Coupons

Language

model-logo

New Website Navigation explained

>> Close
6

Last added items

0 Item(s)

Go to Cart

>> Go to cart X
 

Quick Order

X

Industrial-grade Products & Services

What are industrial-grade products? <<click here >>

Oligonucleotide Synthesis

  • Ultimate Precision Probes
  • NGSgrade Oligos in Tubes
  • NGSgrade Oligos in Plates
  • Request for Oligos in Tubes
  • Request for Oligos in Plates
  • Large Scale Oligos

Gene Synthesis & Molecular Biology

  • Gene Synthesis
  • GeneStrands
  • Express GeneStrands
  • Plasmid Preparation
  • Cloning Service

Next Generation Sequencing

  • Genome (Re-)Sequencing
  • Transcriptome Sequencing
  • Microbiome profiling
  • Exome Sequencing
  • Clinical Research Exome
  • Oncoprofiling
  • Liquid Biopsy Sample Sequencing
  • Ready-to-Load
  • Virus Sequencing
  • Amplicon Sequencing
  • Metagenome
  • ONT products
  • NGS Barcodes & UPS labels
  • Replacement samples
  • NGS Additional Services

Genotyping & Genexpression

  • Cell Line Authentication
  • Fragment Length Analysis
  • Mycoplasmacheck Barcodes
  • Cell Line Barcodes

Oligonucleotide Synthesis

Primers & Probes for qPCR Applications

  • PCR Primer in Tubes
  • PCR Primer NightXpress
  • PCR Primer in Plates
  • LocNA Primer
  • Dual Labeled Probes
  • MGB Probes
  • LocNA Probe
  • Molecular Beacons
  • LightCycler Probes
  • Probe based qPCR Assay
  • Ultimate Precision Probes

Oligos for Next Generation Sequencing

  • NGSgrade Oligos 2.0 Tubes
  • NGSgrade Oligos 2.0 Plate
  • NGSgrade Oligos in Tubes
  • NGS Oligos for NovaSeq
  • NGS Oligos for MiSeq
  • NGS UDI Primer Sets

Primers for Sanger Sequencing

  • SeqPrimer in Tubes
  • SeqPrimer NightXpress
  • SeqPrimer in Plates
  • Standard Primer

Oligos for Cloning Applications

  • Cloning Oligos
  • EXTREmer Oligos

Custom Oligos

  • Custom DNA Oligos in Tube
  • SaltFree Oligo NightXpress
  • Custom DNA Oligos in Plates
  • Custom RNA Oligos
  • O-Methyl-RNA / Chimerics
  • RNA qPCR Probes
  • siMAX siRNA
  • Special Oligos in Tubes

Oligo Tools

  • Oligo Analysis Tool
  • PCR Primer Design
  • SeqPrimer Design
  • qPCR Assay Design
  • siRNA Assay Design
  • Prepaid Oligo Coupons

Gene Synthesis & Molecular Biology

Synthetic genes

  • Gene Synthesis
  • Combinatorial libraries
  • Gene Synthesis Projects

GeneStrands

  • GeneStrands
  • Express GeneStrands

Molecular Biology Services

  • Plasmid Preparation
  • Site Directed Mutagenesis
  • DNA Cloning Service

Sanger Sequencing

Sanger Sequencing Services

  • TubeSeq Supreme
  • PlateSeq Supreme
  • Direct Colony Sequencing
  • Ready2Load Plate
  • Ready2Load Tube
  • Whole Plasmid Sequencing Tubes
  • Whole Plasmid Sequencing Plate
  • TubeSeq NightXpress
  • Primer Walking Service

Prepaid Products for Sanger Sequencing

  • Prepaid Barcodes & Coupons
  • Mix2Seq Kits
  • PlateSeq Kits
  • LightRun Barcodes
  • ONT Coupons

Additional Services

  • Tube & Plate Barcode Labels
  • Sequencing Accessories
  • Sample Shipment
  • Sequencing Primer Design

Next Generation Sequencing

Genome Sequencing

  • INVIEW Resequencing
  • NGSelect DNA
  • Whole Genome Sequencing
  • Bact. Whole Genome Seq (ONT)

Transcriptome Sequencing

  • INVIEW Transcriptome
  • NGSelect RNA

Metagenome / Microbiome

  • INVIEW Microbiome
  • INVIEW Metagenome

Exome Sequencing & Oncology Solutions

  • INVIEW Human Exome
  • Liquid Biopsy Samples
  • INVIEW Oncoprofiling
  • Clinical Research Exome

CRISPR & Prepaid NGS Coupons

  • INVIEW CRISPR Check
  • Redeem NGS Coupons
  • Order NGS Coupons

VIRUS

  • INVIEW Virus

Plasmid Sequencing

  • INVIEW Plasmid Verification
  • Whole Plasmid Sequencing (ONT) Tubes
  • Whole Plasmid Sequencing (ONT) Plate

Amplicon sequencing & Ready-to-Load

  • NGSelect Amplicon
  • NGSelect Ready-to-Load
  • Clonal Amplicons (ONT)

Oxford Nanopore projects (WGS, Amplicons, 16S)

  • ONT projects

ONT Lite

  • ONT Lite Whole Plasmid Sequencing
  • ONT Lite Clonal Amplicon Sequencing
  • ONT Lite Bacterial Genome Sequencing
  • ONT Lite Assembly Review

Additional Services

  • NGS Barcodes & UPS labels
  • NGS Additional Services
  • Sample Submission Guidelines
  • Prepaid NGS Coupons
  • Replacement samples
  • Request for Information

Genotyping & Gene Expression

Mycoplasmacheck

  • Mycoplasmacheck Barcodes
  • Mycoplasmacheck results

CLA & FLA

  • Cell line authentication Service (CLA)
  • Fragment length Analysis (FLA)
  • Cell line authentication barcodes

Others

  • Genotyping request form

EVOcard

Order / Refill EVOcard

Login / Register

 
Email
Password:
Forgot password?
Create Account
No SSL

 

  • Order Menu

    EVOcards

    • Order / Refill EVOcard

    Oligonucleotides & siRNA

    • (q)PCR Primer in Tubes
    • (q)PCR Primer in Plates
    • (q)PCR Primer NightXpress
    • SeqPrimer in Tubes
    • SeqPrimer in Plates
    • SeqPrimer NightXpress
    • Custom DNA Oligos in Tubes
    • Custom DNA Oligos in Plates
    • SaltFree Oligo NightXpress
    • NGSgrade Oligos in Tubes
    • Standard Primer
    • Standard Primer NightXpress
    • LocNA Primer
    • LocNA Probes
    • Dual Labeled Probes
    • MGB Probes
    • Probe based qPCR Assay
    • Cloning Oligos in Tubes
    • EXTREmer Oligos
    • Nano-Scale Plate Oligos
    • NGS UDI Primer Sets
    • Custom RNA Oligos
    • RNA qPCR Probes
    • siMAX siRNA
    • Large Scale Oligos
    • Special Oligo Requests
    • More...

    Custom DNA Sequencing

    • Mix2Seq Kits
    • LightRun Barcodes
    • Sequencing Primers
    • TubeSeq Service
    • SupremeRun Tube
    • Tube & Plate Barcode Labels
    • TubeSeq Labels & Coupons
    • SupremeRun Barcodes
    • Sequencing Accessories
    • PlateSeq Kits
    • SupremeRun 96
    • Primer Walking
    • PlateSeq Service
    • SupremeRun | Multiprimer
    • Sequencing Projects
    • Direct Colony Sequencing
    • Ready2Load Plate
    • More...

    Next Generation Sequencing

    • INVIEW Microbiome 3.0
    • NGSelect DNA
    • Barcode & UPS Labels
    • INVIEW Transcriptome
    • NGSelect RNA
    • Replacement samples
    • INVIEW Resequencing
    • NGSelect Amplicon
    • Sample Submission
    • INVIEW Human Exome
    • Redeem NGS Coupons
    • Request for Information
    • INVIEW CRISPR Check
    • SARS-CoV-2 RNA-Seq
    • More...
    • INVIEW Virus

    Gene Synthesis & Molecular Biology

    • New gene wizard
    • Plasmid Preparation
    • GeneStrands
    • Express Genes
    • DNA Cloning Service
    • Express GeneStrands
    • Gene Synthesis Project
    • Site Directed Mutagenesis
    • Combinatorial libraries
    • Synthetic genes
    • Corona Control Plasmids

    Genotyping & Gene Expression

    • Mycoplasmacheck
    • Cell Line Authentication 2.0
    • Fragment Length Analysis
    • Request for Information

0 Item(s)

Go to Cart

  • Other Languages
  • DNA & RNA
    Oligonucleotides
    • >

      Optimised Application Oligos

    • >
      Ultimate Precision Probes
    • >
      PCR Primers
    • >
      SeqPrimer
    • >
      Cloning Oligo
    • >
      EXTREmers
    • >
      NGSgrade Oligos
    • >

      qPCR Probes

    • >
      NGSgrade Oligos 2
    • >
      Custom DNA & RNA Oligos
    • >
      Custom DNA Oligos
    • >
      Large Scale Oligos
    • >
      Custom RNA Oligos
    • >
      siMAX siRNA
    • >
      Special Requests
    • >
      Salt Free Oligos
  • Custom DNA Sequencing
    • >

      Eurofins Services

    • >
      Mix2Seq
    • >
      Mix2Seq Kits
    • >
      TubeSeq Services
    • >
      TubeSeq Labels & Coupons
    • >
      PlateSeq Service
    • >
      PlateSeq Kits
    • >
      Direct Colony Sequencing
    • >
      Whole Plasmid Sequencing
    • >

      LightRun Services

    • >
      LightRun Barcodes
    • >
      GATC Services
    • >

      Additional Services

    • >
      Tube & Plate Barcode Labels
    • >
      Sequencing Primers
    • >
      Sequencing Accessories
    • >
      Sample Shipment
    • >
      Free Sample Pick-Up
    • >
      Shipping Options
  • Next Generation Sequencing
    • >

      NGS Built For You

    • >
      INVIEW Microbiome
    • >
      INVIEW Transcriptome
    • >
      INVIEW Exome
    • >
      INVIEW Metagenome
    • >
      INVIEW CRISPR Check
    • >
      INVIEW Virus
    • >
      NGS prepaid solutions
    • >
      INVIEW Plasmid Verification
    • >

      NGS Build Your Own

    • >
      NGSelect DNA
    • >
      NGSelect RNA
    • >
      NGSelect Amplicons
    • >
      NGSelect Ready2Load
    • >
      Human Whole Genome Sequencing
    • >
      WGS Select
    • >
      Bacteria Whole Genome Sequencing
    • >
      Amplicon sequencing
    • >
      Amplicon sequencing - full service
    • >

      Applications

  • Gene Synthesis / Molecular Biology
    • >

      Gene Synthesis

    • >
      Standard Genes
    • >
      Express Genes
    • >
      Complex Genes
    • >
      GeneStrands
    • >
      Express GeneStrands
    • >
      Combinatorial Libaries
    • >
      GENEius
      • >

        Molecular Biology Services

      • >
        Plasmid Preparation
      • >
        Site Directed Mutagenesis
      • >

        Applications

      • >
        CRISPR_Cas9
    • Genotyping & Gene Expression
      • >

        Service Platforms

      • >
        Illumina Array Platforms
      • >
        Affymetrix Array Platforms
      • >
        Fluidigm BioMark & EP1
      • >
        Roche LightCycler
      • >
        Sanger & NGS Sequencing
      • >

        Genotyping Services

      • >
        SNP Genotyping
      • >
        Microsatellites / STR / FLA / IDAA
      • >
        Sequencing Based Genotyping
      • >
        Genotyping by PCR
      • >
        Genome Wide Association
      • >
        Human Identification
      • >
        Copy Number Variation
      • >

        Gene Expression Services

      • >
        Transcriptome Analysis
      • >
        Expression Arrays
      • >
        Target Gene Expression
      • >
        miRNA / Small RNAs Analysis
      • >

        Applied Genomics Services

      • >
        Residual DNA Analysis
      • >
        DNA Barcoding
      • >
        Cell Line Authentication
      • >
        Mycoplasmacheck
     

    Industrial-grade gene synthesis

      Intro & Info

    Welcome to our Gene Synthesis order platform.

    How to enter your gene details:
    • Select the entry format of your gene name and gene sequence:
      • Single input: Select the number of genes and enter the information later directly on the page
      • Copy&Paste: if you have a copy ready format of all your genes you can easily paste them in here
      • File-Upload: use our Excel template to upload your sequences and names.
    • Additional Options:
      • Here you need to define all properties for your genes: optimisation required, restriction sites, subcloning vectors and plasmid preparation scale
    • Sequence validation:
      • For customers using "Single input" you now need to add your gene sequence
      • For all other entry formats the gene sequences are displayed here.
      • All sequences will now be checked for complexities and in case of codon optimisation it will directly be optimised
    • Summary & Review:
      • If your genes apply for "Express Genes" you can select here the express production times. In addition you can download a summary of your gene order.

    The gene synthesis wizard is able to manage all kind of genes: Standard, Complex and Express Genes.

    Using Templates:
    • If you order genes on a regular basis you can save your "additional options" as template and simply select the correct template.
    • You can add several templates to ensure that you have one template for each gene category you need.

    Email notification for gene optimisation:
    If you are logged in while entering your gene order you don't need to wait for GENEius to optimise your sequence. Our system will do that for you in the background and inform you via Email when the optimisation is successfully performed. The order will automatically be placed in your cart.

    Risk group classification sheet

    For gene synthesis orders including subcloning please download the risk group classification sheet and send the filled form to genes-eu[at]genomics.eurofinseu.com after placing your order.
     
    • Entry Format
    • Additional Options
    • Sequence Validation
    • Summary & Review
     

    Entry Formats



    Number of genes:
     
    Please select the number of genes you want to order and press "Next".
    You can always add more or leave lines empty on the next page.
     
     
    Gene sequences can be DNA or Amino Acid. Name and sequence can be separated by a blank, tab, comma or semicolon:

    Gene1[blank]TACGACGGAGTGTTATAAGATGGGAAATCGGATACCAGATGAAATTG
    Gene2[TAB]TACGACGGAGTGTTATAAGATGGGAAATCGGATACCAGATGAAATTGTG
    Gene3,FTGSNVEDRSSSGSWGNGGHPSPSRNYGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKSQY
    Gene4;SWGNGGHPSPSRNYGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTSYSSYGRESN

    XLS Icon Download our Excel template for uploading your genes.
    Allowed file formats are xls, xlsx and csv. The file needs two columns named name and sequence without a special format.
     
     
     
    Define your genes by using our Excel template above. Upload your file and press "Next".
     
     
    Next
     
    Production Site
    • Europe
    • America
    • India
    • Japan
    Eurofins Genomics
    • Terms & Conditions
    • Sitemap
    • Imprint
    • Privacy
    • Licenses
    • Cookie Settings
    Contact
    General Customer Support
    phone +49 7531 816068
    Toll free phone number for
    Europe: 00800 200 100 20
    support-eu@genomics.eurofinseu.com

    Eurofins Genomics Europe Shared Services GmbH
    Anzinger Str. 7a
    85560 Ebersberg
    Germany

    /p>

    2025 - Eurofins Genomics

    VEGA Beta